SecReT6
Protein ID: 260595864
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00720
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]71550..73022 [+]
Producthypothetical protein
NoteTssC
UniProt IDC9Y419
KEGG IDctu:CTU_00720
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.10E-197, Aligned region: 57..483
Protein Sequence: 490 a.a.     [Download]
>gi|260595864|ref|YP_003208435.1| unnamed protein product [Cronobacter turicensis z3032]
MQSQQAFSQDEFSALLSKEFRPKTDQARSAVENAVKTLAQQALENTVTFSNDTYRTIQNLIAGIDEKLSQ
QVNQIIHHDEFQKLESAWRGLNYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQSPIFKKIYEE
EYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAAAHCPFITGTAPSVMQMESWQELANPRDLTKIF
QNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHSNYNWSNAAYAMAANI
NRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFMPLIHRKNSD
FAAFIGAQSLQKPAEYHDPDATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEMERWLNDWVM
NYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKLPSLKSNEA
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|325295716|ref|NC_013282.2|:71550-73022 Cronobacter turicensis z3032 chromosome, complete genome
CTGCAGTCGCAGCAGGCATTCAGCCAGGACGAATTCAGCGCGCTGCTCAGCAAAGAGTTTCGCCCGAAAA
CCGACCAGGCGCGTTCGGCCGTCGAAAACGCGGTAAAAACCCTGGCGCAGCAGGCGCTGGAAAACACCGT
CACCTTCTCAAACGACACCTACCGCACCATTCAGAACCTGATTGCCGGTATCGACGAGAAGCTGTCTCAG
CAGGTTAACCAGATTATTCACCACGACGAGTTCCAGAAGCTGGAAAGCGCCTGGCGTGGCCTGAACTATC
TGGTCAACAACACTGAAACCGACGAGATGCTGAAAATCCGCTTTATGAGCATCTCCAAGCAGGAACTGGG
CCGCACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGCCCGATCTTCAAGAAAATCTACGAAGAA
GAGTATGGCCAGTTCGGCGGCGAGCCGTTTGGCTGCCTGGTGGGCGACTACTACTTCGACCACAGCCCGC
AGGATGTTGAACTGCTGAGCGAAATGGCGCGCATCGGCGCGGCGGCGCACTGCCCGTTCATCACCGGCAC
CGCGCCGAGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCGAACCCGCGCGACCTGACCAAAATCTTC
CAGAACACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAGTCGGAAGATGCGCGTTATCTGGGCCTCGTCA
TGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCATTCGCACTAATCCGGTGGACAGCTTCGACTTCGAAGA
AGAGACCGACGGCGCGAACCACAGCAACTACAACTGGTCCAACGCGGCCTACGCGATGGCGGCCAACATC
AACCGTTCCTTTAAAGAGTACGGCTGGTGCACCTCCATTCGCGGCGTGGAATCGGGCGGCGCGGTAGAAA
ACCTGCCGTGTCACACCTTCCCGAGCGACGACGGCGGCGTGGACATGAAATGCCCGACCGAAATCGCCAT
CAGCGATCGTCGCGAAGCGGAGCTGGCGAAAAACGGCTTTATGCCGCTGATCCACCGTAAAAACTCCGAC
TTCGCCGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCGGAATACCACGATCCGGACGCCACCGCGA
ACGCCCGTCTGGCAGCCCGCCTGCCGTACCTGTTCGCCTGCTGCCGTTTCGCGCACTACCTCAAGTGCAT
CGTTCGCGACAAGATCGGTTCTTTCCGCGAGCGCGACGAAATGGAACGCTGGCTGAACGACTGGGTGATG
AACTACGTGGACGGCGACCCGGCGAACTCCTCTCAGGAAACCAAATCCCGCAAGCCGCTGGCCGCGGCCG
AGGTTCAGGTTCAGGAGATCGAGGACAACCCAGGCTACTACGCCGCCAAGTTCTTCCTGCGTCCGCACTA
CCAGCTGGAAGGCCTGACCGTTTCTCTGCGTCTGGTCTCCAAACTGCCGTCTCTGAAGAGCAACGAGGCG
TAA