SecReT6
Protein ID: 260595872
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00800
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]77053..77619 [+]
Producthypothetical protein
NoteFha
UniProt IDC9Y427
KEGG IDctu:CTU_00800
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 188 a.a.     [Download]
>gi|260595872|ref|YP_003208443.1| unnamed protein product [Cronobacter turicensis z3032]
MQPTPQFDRDNMRQLGQMLSMFSQGTVALLSSRSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFG
TRMPGFMPPKKSVRDALIDLQAHQLGMIAGIRAIIAAMLQSFNPEQLEEEAKRDGAISRLALPASRKAAL
WDYFVRHYSDTAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQSGSEEE
 
Nucleotide Sequence: 567 bp     [Download]
>gi|325295716|ref|NC_013282.2|:77053-77619 Cronobacter turicensis z3032 chromosome, complete genome
CTGCAACCGACGCCGCAGTTCGACCGCGACAATATGCGCCAGCTTGGCCAGATGCTCAGCATGTTTTCGC
AGGGCACCGTGGCGCTGCTCTCCTCGCGCTCGATCCTCAAGCGCGGCGTAAAAGCCGACATGACAATGGT
GCTGGATGACGCGAACAACCCGTTCAAACTGCTGCCATCGGGTAAAACCGTGCTGATGCAGATGTTCGGC
ACCCGTATGCCGGGCTTTATGCCGCCGAAAAAATCGGTGCGCGACGCGCTTATCGATCTCCAGGCCCACC
AGCTTGGGATGATCGCCGGTATCCGCGCCATCATCGCCGCCATGCTGCAATCCTTTAACCCGGAGCAGCT
GGAAGAAGAGGCGAAGCGCGATGGCGCTATCTCTCGTCTGGCGCTGCCGGCGAGCCGCAAAGCCGCGCTG
TGGGATTACTTTGTGCGTCATTACAGCGATACCGCCGGTGAAATCGAGGACGATTTCCATACCCTGTTCG
GCGAAGCCTTCCTGCACGCTTATGACATGGAAGTGAATCAGTACAAAGACTCACAAAGCGGATCGGAAGA
AGAATGA