SecReT6
Protein ID: 260595875
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00830
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]79447..80280 [+]
Producthypothetical protein
NoteTagJ
UniProt IDC9Y430
KEGG IDctu:CTU_00830
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.40E-44, Aligned region: 146..268
Protein Sequence: 277 a.a.     [Download]
>gi|260595875|ref|YP_003208446.1| unnamed protein product [Cronobacter turicensis z3032]
MNTLYQQLAGASVSDALSRLEADIKAQPGNADRRAAFVQFLCLNANWTRALTQLKSWAALAPQAQPTVTL
LQQAIEGEQQRAEVLAGRARPRMPGEQWPWLDLLLKALAETDPARASSLRNDALEQAEANPGELTLAAGD
APGEPVRFDWLMDGDARLGPVCELIVNGNYFWVPFSAIASVRFQAPASVTDLVWRHAMVQLVDGTEQVCQ
IPARYPLETGAEDRFLLARTTEWQPLDAEGIHYLGAGQKVWLSGEQEFALLTLDTLAFGLPDDASHE
 
Nucleotide Sequence: 834 bp     [Download]
>gi|325295716|ref|NC_013282.2|:79447-80280 Cronobacter turicensis z3032 chromosome, complete genome
ATGAACACGCTGTATCAACAACTGGCTGGCGCAAGCGTCAGCGACGCGCTGAGCCGCCTTGAGGCCGACA
TCAAAGCCCAGCCGGGCAACGCCGATCGCCGCGCCGCGTTTGTGCAGTTTCTCTGCCTGAACGCCAACTG
GACCCGCGCGCTCACCCAGCTGAAAAGCTGGGCCGCGCTGGCGCCCCAGGCGCAGCCGACCGTGACGCTG
CTGCAACAGGCTATCGAAGGCGAGCAGCAGCGCGCCGAAGTGCTGGCGGGTCGCGCGCGTCCGCGGATGC
CGGGCGAACAGTGGCCGTGGCTGGATCTGCTGCTGAAAGCGCTGGCGGAAACCGACCCGGCGCGCGCAAG
CAGCCTGCGCAACGACGCGCTGGAACAGGCCGAGGCCAATCCTGGCGAGCTGACGCTGGCGGCGGGCGAC
GCGCCCGGCGAGCCGGTGCGTTTTGACTGGCTGATGGACGGCGATGCGCGTCTGGGGCCGGTGTGCGAGC
TTATCGTTAACGGCAACTACTTCTGGGTGCCGTTCAGCGCTATCGCGTCGGTTCGTTTCCAGGCCCCGGC
GAGCGTCACCGATCTGGTGTGGCGTCACGCGATGGTGCAGCTGGTGGACGGCACCGAACAGGTGTGCCAG
ATCCCGGCGCGCTACCCGCTGGAAACCGGCGCGGAAGACCGCTTCCTGCTGGCGCGCACCACCGAGTGGC
AGCCGCTGGACGCGGAAGGCATTCATTATCTCGGCGCGGGTCAGAAAGTCTGGCTGAGCGGCGAACAGGA
GTTCGCGCTGCTGACGCTGGATACGCTCGCTTTCGGGCTACCGGACGACGCATCGCATGAATAA