SecReT6
Protein ID: 260595876
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00840
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]80273..80845 [+]
Producthypothetical protein
NoteTssE
UniProt IDC9Y431
KEGG IDctu:CTU_00840
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 58..166
Protein Sequence: 190 a.a.     [Download]
>gi|260595876|ref|YP_003208447.1| unnamed protein product [Cronobacter turicensis z3032]
MNKPYQDDDSGDLLRHGYRSRRNASTVTARDKMQPSLLDRLTDNAPDKRQEPANSNLVSHSALRRQVLRD
LQWLFNTINNEAQQDLSRVDHVRRSVFNFGVAPLAGKRMSEIEWGDIQQRLTEAILHFEPRILPQGLQVR
CVCDTKSLDLHNVLSIEIKGRLWCVPWPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|325295716|ref|NC_013282.2|:80273-80845 Cronobacter turicensis z3032 chromosome, complete genome
ATGAATAAACCGTATCAGGATGACGACAGCGGCGATCTGCTGCGCCACGGCTACCGTTCGCGCCGCAACG
CCTCGACGGTCACCGCACGCGACAAAATGCAGCCCTCGCTGCTGGACCGTCTGACCGATAACGCGCCGGA
CAAGCGTCAGGAGCCGGCGAACAGCAATCTCGTCTCCCACAGCGCGCTGCGTCGCCAGGTGCTGCGCGAT
TTGCAGTGGCTGTTCAACACCATTAATAACGAAGCGCAGCAGGATCTCAGCCGGGTGGACCATGTGCGCC
GCTCGGTGTTTAACTTCGGCGTGGCGCCGCTCGCGGGCAAGCGGATGTCGGAGATTGAGTGGGGCGACAT
CCAGCAGCGGCTTACCGAGGCGATTTTGCACTTCGAACCGCGCATTCTGCCGCAGGGGTTGCAGGTGCGC
TGCGTCTGTGACACCAAATCGCTCGACCTGCACAACGTATTATCTATCGAGATTAAAGGCCGCCTGTGGT
GCGTGCCCTGGCCGCTCGAATTTCTGTTCCGCACCGATGTGGATCTGGAAAACGGCCATTTTGAGCTTAA
AGACGCGGGGTAA