SecReT6
Protein ID: 260595877
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00850
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]80848..82719 [+]
Producthypothetical protein
NoteTssF
UniProt IDC9Y432
KEGG IDctu:CTU_00850
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-208, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|260595877|ref|YP_003208448.1| unnamed protein product [Cronobacter turicensis z3032]
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEIADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQLLKKNGVTCSYATAHDVRLLP
LHISLVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGPVLLNHLDFDRLDFFLSGPDIQALQLLELLM
EHRVGIFCQTVGPKPSRVVLDDDALRQEGFEADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGISK
LLAQSGQANAFDIIILLDKTDTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPL
DYEIFSVSKIYASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSMRREQRALSEHALRYGTRTGYIGSEAFV
SLVDATHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHCVLEPVHRRVPEPGPIVFARG
VGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEFTLKSQQRGEVGYWGPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|325295716|ref|NC_013282.2|:80848-82719 Cronobacter turicensis z3032 chromosome, complete genome
ATGGACAGTAAACTGCTCGAATACTACAACCGAGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAATTCG
CCGAACGCTACCCGAAAGTGGCGGGCAGGCTCGGTATGCGCGGCATTGAAATCGCGGACCCGTACATCGA
GCGCCTGATGGAAGGCTTCGCCTTTCTCACCTCCCGCGTGCAGCTCAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGCTCGCGCCGAATTATCTGGCGCCGACGCCGTCAATGGCGATTGCCG
AACTGCACCCGGACAGCGCCAAAGGGGATTTAAGCAACGGGTTCGTGGTGCCGCGCGGCACGATGATGGA
CAGCCAGCTTCTGAAAAAGAACGGCGTCACCTGTAGCTACGCTACCGCCCATGACGTTCGCCTGCTGCCG
CTGCATATCAGCCTGGTGGAATTAGGCGGCGTACCGGCCGACGCGCCGTTAAGCCAGCTCGGCTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCGTGCGCATCGCGTGCGACGGCCCGGTGCTGCTCAACCATCTCGA
TTTCGACCGCCTTGATTTCTTCCTGAGCGGGCCGGATATCCAGGCGCTGCAACTGCTGGAGCTCCTGATG
GAGCACCGCGTCGGCATCTTCTGTCAGACCGTCGGCCCGAAACCGTCACGCGTGGTGCTCGACGATGACG
CGCTGCGTCAGGAAGGCTTTGAGGCCGACCAGGCATTGCTGCCGGACGATCTGCGTAATTTCGACGGCTA
CCGCCTGTTGCAGGAATATTTCGCGTTCCCGGCGCGCTTCCAGTTCTTAAGCCTGCGCGGCATCAGCAAG
CTGCTGGCGCAGAGCGGGCAGGCGAACGCGTTCGATATCATCATCCTGCTCGATAAAACCGACACGCCGC
TGGAGCGCGTGGTGGATAAAAGCCACCTCGCGATGCACTGCACGCCGGTCATCAATTTGTTCCCGAAAAT
CGCCGAGCGCCAGAAGCTCACCGAGGGCTTAAGCGAATACCACCTGGTGGTGGATAACATTCGCCCACTC
GATTACGAGATTTTCTCGGTCAGTAAAATTTACGCCAGCGAAGACGGCCAGCGCGACGATCAGATTTTCC
GCCCGTTCTGGAGCACCTGGAGCCGCGACGGCGGCAACTACGGCGCGTATTTCTCGATGCGCCGCGAACA
GCGCGCGCTCTCGGAACACGCGCTGCGCTACGGCACGCGTACGGGGTATATCGGCTCCGAGGCGTTTGTG
TCGCTGGTGGATGCAACCCACGCGCCCTGGCGCGACGAGCTGCGCTATATCACCGCCGAAGTGATGTGTA
CCAGCCGCGATCTGCCGCTGATGCTGGCGCAGGATATGGGCCAGTTCGTGCTGCCGGATTCCATGCCGGT
GCGCGCGCTTACCATGCGCAAAGGGCCGACGCCGCCGCGTCCGGCGCTGGCCGAAGGATTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAAATGAACTATTTAAGCCTGATGGACGCCGAAGATGGCGAAGGCGCCGCCG
CGCTGCGTCAGCTGCTCGGCCTCTACGCGCGCCTGGCGGAAGCGCCGGTGGCGCGCCAGATTGACGGCAT
TCGCCACTGCGTGCTGGAGCCGGTGCATCGCCGCGTGCCGGAGCCAGGCCCGATTGTCTTCGCCCGCGGC
GTCGGGATTTCGATGACCGTCGACGAACAGGCGTTTTCCGGCTCCAGCCCGTGGCTGCTTGGCAGCGTTC
TGGAGCGCGTCTTCGCACGCCTGGTCTCGATGAACAGCTTCACCGAGTTCACCCTCAAGAGCCAGCAGCG
CGGCGAAGTGGGTTACTGGGGCCCGCGGATGGGTAAAAGGGCGCTGATATGA