SecReT6
Protein ID: 260595878
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00860
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]82716..83759 [+]
Producthypothetical protein
NoteTssG
UniProt IDC9Y433
KEGG IDctu:CTU_00860
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-107, Aligned region: 27..331
Protein Sequence: 347 a.a.     [Download]
>gi|260595878|ref|YP_003208449.1| unnamed protein product [Cronobacter turicensis z3032]
MSETLPQNAPVKSASRLPENYWQQMMAAPWRYDLFQMLRRLDAQGGERYRLGRAPLPRFEPLRIGQQPSM
AFAPSTLAAVKPRDNTPLHDVSILSFGLFGPNGPLPMHLTEYARERLYHHQDDSLSAFADLFHHRLTLLF
YRAWADAQPTASLDRADGPRIEKYLAALIGMGQPGQMEKGSLSHHARYSLVGHLTRNGRDAEGLEKILRH
YFRVPVTIVQNIPQWMPLTEREKARLGAGRRIPRLGNAAFLGVAVRDVQHKFRIELGPLDEETYQRFLPG
EPWVEELRDWVRQYMGIEYEWEVRVILRADAVKGVTPGGTGRLGYSAWLGKQPTPQPRGDLVFRAES
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|325295716|ref|NC_013282.2|:82716-83759 Cronobacter turicensis z3032 chromosome, complete genome
ATGAGTGAGACGCTGCCACAGAACGCGCCGGTAAAAAGCGCGTCCCGGCTGCCGGAAAACTACTGGCAAC
AGATGATGGCCGCGCCGTGGCGCTACGATCTGTTCCAGATGCTGCGCCGTCTCGACGCGCAGGGCGGCGA
ACGCTACCGTTTAGGCCGCGCGCCGCTGCCGCGCTTTGAGCCGCTGCGCATCGGCCAGCAGCCGTCGATG
GCCTTTGCGCCGTCGACGCTTGCCGCGGTGAAACCGCGCGACAACACGCCGCTGCACGATGTGTCGATTT
TAAGCTTCGGCCTGTTTGGCCCGAACGGCCCGCTGCCGATGCACCTGACCGAATATGCGCGCGAGCGTCT
GTATCATCATCAGGATGACAGCCTGAGCGCGTTCGCGGATCTGTTTCATCACCGCCTGACGCTGCTGTTC
TACCGCGCCTGGGCCGATGCCCAGCCGACCGCGTCGCTCGACCGCGCCGACGGGCCGCGCATTGAAAAAT
ACCTCGCCGCCCTTATCGGCATGGGCCAGCCGGGGCAGATGGAAAAGGGCAGCCTGAGCCACCACGCGCG
CTATTCGCTGGTCGGCCATCTGACCCGCAACGGGCGCGACGCCGAAGGGCTCGAAAAAATCCTGCGCCAC
TATTTCCGCGTGCCGGTGACGATTGTGCAGAACATCCCGCAGTGGATGCCGTTAACCGAGCGTGAGAAAG
CGCGTCTCGGCGCGGGCCGCCGGATACCGCGCTTGGGCAACGCCGCGTTTCTCGGCGTGGCGGTGCGCGA
CGTACAGCATAAATTTCGCATTGAACTCGGGCCGCTGGATGAAGAGACCTATCAGCGTTTTCTGCCCGGC
GAGCCGTGGGTTGAGGAGCTGCGCGACTGGGTGCGTCAGTATATGGGCATTGAGTATGAGTGGGAGGTGC
GCGTCATTCTGCGCGCCGATGCGGTGAAAGGCGTCACGCCTGGCGGCACGGGCCGTCTGGGCTACAGCGC
CTGGCTTGGGAAGCAGCCCACCCCGCAACCGCGCGGCGATCTGGTTTTTCGCGCGGAAAGTTAA