SecReT6
Protein ID: 260595883
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00910
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]90495..93146 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y438
KEGG IDctu:CTU_00910
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-74, Aligned region: 39..344
Phage_base_V [PF04717], Evalue: 6.40E-24, Aligned region: 382..475
Protein Sequence: 883 a.a.     [Download]
>gi|260595883|ref|YP_003208454.1| unnamed protein product [Cronobacter turicensis z3032]
MLCRYTRNRIRHYGMKTMLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVT
VTIPTQALMTPRYLNGKVTRVAVTAVELSGTRYAAYELTVEPDLWPMHRDRNLRIFQGQTVPQIVKTLLG
ESRVNMEERLSGSYRVWEYCVQYQESSLDFISRLLELEGITYHFRHEQDRHTLILTDAPGQYEPFPGYET
IPYHVTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFV
EHGHGEFYARIRQERWQVEHRQTQGSGTALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGP
DSNTLHEIRFEVIPADVPYRPSQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTS
SSWVRVSSAWAGQGFGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSK
DGSPDNANALRFEDKAGEEQVWLQAERNLDTKVKNDESHTVHGARSHYVRKNELHRVEENQIQAVKGGTE
ILTGKGKLDAVVEQYVLASGTKLRLVCGESAIELNANGKINLIGKDFNFFVEGDGYITTGGKLHLNTAGT
QPGTTAPGSGHKENIKTAVEQHFTPQKSVKNATPALATAPAKTSIKPAPALKSSPPLKGDYVYKNDPSDS
QIMPFSEDVVKEINKSPTLQTQMKALKSQGWSILPGPKGGGCYTDVANKFIVMDPEYMETPTDTVQTLAH
EAGHALYPVAEDYSSRENFINSQLMDEGGATLNNIKVQREILANGGIDIDIAGSEENLAAYNSIYDKMDR
GDLSRTSAAQAIGKIYGKGEIASGGDVNYADKYGAFYDSKMGK
 
Nucleotide Sequence: 2652 bp     [Download]
>gi|325295716|ref|NC_013282.2|:90495-93146 Cronobacter turicensis z3032 chromosome, complete genome
CTGCTTTGCCGCTACACACGCAATCGCATAAGACATTATGGAATGAAGACTATGCTCAACCGAATCACCG
TTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGGCGCGAGGCGCTGTCGGAGCCGTTCAT
GTTCACCCTGACGCTGCTCGGCACTGACGCACGCGCCGACCGCAGCGCGCTGCTGGGGCAGCCGGTGACG
GTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTCAACGGCAAGGTGACCCGCGTGGCGGTGA
CCGCCGTGGAGCTTTCCGGCACCCGCTACGCGGCCTATGAGCTGACGGTGGAGCCGGACCTGTGGCCGAT
GCATCGCGACCGTAACCTGCGTATCTTCCAGGGCCAGACGGTGCCGCAGATAGTGAAAACGCTGCTCGGC
GAAAGCCGGGTCAACATGGAAGAGCGTCTTTCCGGCAGCTACCGGGTCTGGGAGTACTGCGTGCAGTACC
AGGAGAGCAGTCTCGACTTCATCAGCCGCCTGCTGGAGCTGGAAGGCATCACCTATCACTTCCGTCACGA
GCAGGACCGCCATACGCTTATCCTCACCGACGCCCCCGGCCAGTATGAGCCGTTCCCGGGCTACGAGACC
ATTCCGTACCATGTGACCCCTTCAGGCGGCAGTACAGATGAAGAGGGCATCAGCCAGTGGGCGCTGGAGG
ACAGCGTGACGCCGGGCATCTACAGCCTCGATGATTACGACTTCCGCAAGCCGAACGCGTGGCTGTTCCA
GGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGCATTGACGTCTACGACTGGCCGGGCCGCTTTGTG
GAGCACGGTCACGGCGAGTTCTACGCCCGCATCCGCCAGGAGCGCTGGCAGGTGGAGCACCGCCAGACGC
AGGGCTCCGGCACCGCGCTGGGCATCGCGCCGGGCCACACCTTCGTGCTGCGCAACGCCCCGTTCTTCGG
GGATAACGGCGAGTACCTGACCACGGTGGCGCATTACCGCTTTGAGGAAAACCGCTACGCCAGCGGCCCG
GACAGCAACACCCTCCACGAAATCCGCTTTGAAGTGATACCGGCGGACGTGCCGTACCGCCCGTCGCAGA
AGACGCCGTGGCCCAGAACTTACGGCCCGCAGACGGCGAAGGTGGTCGGCCCGCAGGGCGAGAGTATCTG
GACCGACAAATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGTCTCGGCAAGGGCGACGACACCAGT
TCCAGCTGGGTGCGTGTGTCGAGCGCGTGGGCGGGCCAGGGCTTCGGCGGGGTGCAGATACCGCGCGTGG
GCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGATTACCGGGCGCGTGTACAA
CGAAGCGAGTATGCCGCCGTGGGCGCTGCCGGCGGCGGCGACGCAGATGGGCTTTTTAAGCCGCTCGAAG
GACGGCTCGCCGGACAACGCCAACGCCCTGCGCTTTGAAGACAAGGCGGGCGAGGAGCAGGTGTGGCTGC
AGGCCGAGCGCAATCTCGATACCAAAGTGAAAAATGACGAGTCGCATACCGTCCACGGCGCGCGCAGCCA
TTATGTACGTAAAAATGAATTACATCGCGTCGAAGAGAATCAGATTCAGGCGGTTAAAGGCGGCACCGAA
ATCCTGACAGGAAAGGGCAAGCTGGACGCCGTTGTTGAACAATATGTTCTGGCCTCAGGAACCAAGCTGC
GTCTGGTCTGCGGTGAAAGTGCCATTGAACTCAATGCAAACGGCAAAATTAATCTGATCGGTAAAGATTT
TAATTTCTTTGTCGAAGGGGATGGCTATATTACGACAGGCGGTAAGCTACACCTTAATACTGCCGGTACA
CAGCCAGGAACGACCGCGCCGGGTTCGGGTCATAAAGAAAATATAAAGACTGCGGTAGAACAACATTTTA
CGCCGCAGAAAAGTGTAAAAAATGCTACTCCGGCTTTAGCCACCGCGCCAGCCAAAACAAGCATAAAACC
TGCTCCCGCCCTTAAATCATCTCCACCATTGAAAGGCGATTACGTCTATAAAAACGATCCTTCCGACTCA
CAAATAATGCCTTTCAGCGAAGATGTTGTTAAGGAGATTAATAAATCACCAACGCTGCAGACACAGATGA
AAGCTTTAAAATCCCAAGGATGGTCAATCCTGCCAGGCCCAAAAGGCGGAGGATGTTATACAGATGTCGC
GAACAAGTTTATTGTTATGGATCCAGAATATATGGAAACACCCACTGATACTGTGCAAACACTTGCGCAT
GAGGCTGGTCATGCGCTATATCCGGTTGCTGAAGATTACTCCAGCCGGGAAAATTTTATTAATAGTCAAC
TCATGGATGAAGGTGGAGCAACGTTGAATAATATTAAAGTTCAGCGTGAAATTCTGGCTAATGGCGGTAT
CGATATTGATATCGCAGGCTCCGAAGAAAATTTGGCAGCGTATAATTCAATCTATGACAAAATGGACCGT
GGTGACTTATCTCGAACTAGCGCAGCACAAGCTATAGGCAAAATATATGGCAAAGGTGAAATAGCTTCAG
GTGGAGATGTAAATTATGCGGACAAGTACGGGGCCTTTTATGATAGTAAAATGGGAAAATAA