SecReT6
Protein ID: 260595892
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_01000
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]101228..103381 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y447
KEGG IDctu:CTU_01000
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-75, Aligned region: 27..332
Phage_base_V [PF04717], Evalue: 2.40E-24, Aligned region: 370..463
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 506..528
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 522..543
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 546..567
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 561..584
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 570..592
Gp5_C [PF06715], Evalue: 8.90E-16, Aligned region: 586..607
Protein Sequence: 717 a.a.     [Download]
>gi|260595892|ref|YP_003208463.1| unnamed protein product [Cronobacter turicensis z3032]
MWTEVMLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPR
YLNGKVTRVAVTAVELSGTRYAAYELTVEPDLWPMHRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSG
SYRVWEYCVQYQESSLDFISRLLELEGITYHFRHEQDRHTLVLTDAPGQYEPFPGYETIPYHVTPSGGST
DEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIR
QERWQVEHRQTQGSGTALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGPDSNTLHEIRFEV
IPADVPYRPSQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSGWVRVSSAWAG
QGFGGVQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRF
EDKAGEEQVWLHAEKNMDTDIENDETHSVGSNRTKTIGANETTTVKKNRTETVVENETITVHQNRTETVD
GNETITIHSNRNETVDQNEEVRIGQNQSVTVNGAQTLRVDKTKTETIALASMLNVGLAQNTNIGAAYVLN
VGAGWMTNVGAMQMHNVALKYSVNSGKDLSLSAGTTADFRAEDKITLVCGESMIVLEQNGTITLSANKIK
MVGEKVIDIDGTEININ
 
Nucleotide Sequence: 2154 bp     [Download]
>gi|325295716|ref|NC_013282.2|:101228-103381 Cronobacter turicensis z3032 chromosome, complete genome
ATATGGACTGAAGTTATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAAC
TCTCCGGGCGCGAGGCGCTGTCGGAGCCGTTCATGTTCACCCTGACGCTGCTCGGCACTGACGCACGCGC
CGACCGCAGCGCGCTGCTGGGCCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGC
TACCTCAACGGCAAGGTGACCCGCGTGGCGGTGACCGCCGTGGAGCTTTCCGGCACCCGCTACGCGGCCT
ACGAGCTGACGGTGGAGCCGGACCTGTGGCCGATGCATCGCGACCGCAACCTGCGTATCTTCCAGGGCCA
GACGGTGCCGCAGATAGTGAAGACGCTGCTGGGCGAAAGCCGGGTGAATATGGAAGAGCGGCTGTCGGGC
AGCTACCGCGTCTGGGAGTACTGCGTGCAGTACCAGGAGAGCAGTCTGGACTTCATCAGCCGCCTGCTGG
AGCTGGAAGGCATCACCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTGGTGCTCACTGACGCCCC
CGGCCAGTACGAGCCGTTCCCCGGCTACGAGACCATTCCGTATCACGTCACCCCATCAGGCGGTTCAACC
GACGAAGAGGGCATCAGCCAGTGGGCGCTGGAAGACAGCGTGACGCCGGGTATCTACAGCCTCGATGACT
ACGACTTCCGCAAGCCGAACGCGTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAG
CATTGACGTCTACGACTGGCCGGGCCGCTTTGTGGAGCACGGTCACGGCGAGTTCTACGCCCGTATCCGC
CAGGAGCGCTGGCAGGTGGAGCACCGCCAGACCCAGGGCTCCGGCACCGCGCTGGGCATCGCGCCGGGCC
ACACCTTTGTGCTGCGCAACGCGCCGTTCTTCGGGGATAACGGCGAGTACCTGACCACGGTGGCGCATTA
CCGCTTCGAGGAAAACCGCTACGCCAGCGGGCCGGACAGCAACACCCTCCACGAAATCCGCTTTGAAGTG
ATACCGGCGGACGTGCCGTACCGCCCGTCGCAGAAGACGCCGTGGCCCAGAACTTACGGCCCGCAGACGG
CGAAGGTGGTCGGCCCGCAGGGCGAAAGCATCTGGACCGACAAATATGGCCGGGTGAAGGTGAAATTCCA
CTGGGACCGCCTCGGCAAGGGCGACGACACCAGCTCCGGCTGGGTGCGTGTGTCGAGCGCGTGGGCGGGC
CAGGGTTTTGGCGGGGTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACC
CGGACCGCCCGCTGATTACCGGGCGCGTGTACAACGAAGCGAGTATGCCGCCGTGGGCGCTGCCGGCGGC
GGCGACGCAGATGGGCTTTTTAAGCCGCTCGAAGGACGGCTCGCCGGACAACGCCAACGCCCTGCGCTTT
GAAGACAAGGCGGGCGAGGAGCAGGTGTGGCTGCATGCTGAAAAGAATATGGATACCGACATCGAGAACG
ATGAAACGCATTCGGTAGGCAGCAACCGCACCAAAACCATTGGCGCCAATGAAACCACGACGGTGAAGAA
AAACCGCACGGAAACGGTCGTGGAAAATGAAACGATCACGGTGCATCAGAACCGCACAGAGACGGTGGAT
GGCAACGAAACCATCACTATTCATTCCAACCGTAACGAGACGGTCGATCAGAATGAAGAGGTGCGTATCG
GGCAAAACCAGAGCGTGACCGTTAACGGCGCCCAGACGCTGCGCGTCGATAAGACCAAAACCGAGACCAT
TGCGCTCGCCTCCATGCTGAACGTTGGCCTCGCGCAAAACACCAACATTGGCGCGGCGTATGTGCTGAAC
GTCGGCGCGGGCTGGATGACTAACGTCGGCGCGATGCAGATGCATAACGTGGCGCTCAAATATTCGGTGA
ACTCCGGCAAAGATCTCAGCCTGTCTGCGGGCACCACGGCGGATTTCAGAGCGGAAGATAAAATCACGCT
GGTCTGCGGGGAGTCGATGATTGTGCTGGAACAGAACGGCACCATTACGCTTAGCGCCAATAAGATCAAG
ATGGTCGGCGAGAAGGTCATCGACATCGACGGTACGGAAATCAATATCAACTGA