SecReT6
Protein ID: 260597001
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12090
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1263593..1264657 [-]
Producthypothetical protein
NoteTssG
UniProt IDC9XYK4
KEGG IDctu:CTU_12090
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-93, Aligned region: 34..333
Protein Sequence: 354 a.a.     [Download]
>gi|260597001|ref|YP_003209572.1| unnamed protein product [Cronobacter turicensis z3032]
MESASRKTGDPVMASVPAAKAPLPPALNAWCQSDTPWKSGFISTLRAIAARTPDQPPVGHAALPSQESFR
IGQRAHMAFAPREIAQLNWRDGKVNLNIFGPGVWGAQGAMPLHFTELAYSRMENHDYALADFVDLFHHRA
LSHFYRAWFIAQDTATLDRTDDEKFAFYVGSLAGLDLQEIAHSCLPAHARLTSCAHLVREARNPEGLLGA
LQDYFQVPVHIKEFVGQWILLDRTDQTHLGNGDTAILLGKSAILGETVLDRQHKFQLIIGPLTLEQYLRF
SPWGQDLPVLKEWVRNFIGFEYAWEVQLLLKAQEVPCTSLDGTHQLGYASWLAREASIKPLLGMCFEPEF
KQNN
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|325295716|ref|NC_013282.2|:c1264657-1263593 Cronobacter turicensis z3032 chromosome, complete genome
CTGGAAAGCGCGTCCCGGAAGACGGGGGATCCTGTAATGGCATCTGTACCCGCAGCGAAAGCGCCTCTGC
CCCCGGCTCTGAATGCCTGGTGTCAAAGTGATACTCCGTGGAAATCAGGTTTCATCAGCACGCTGCGTGC
TATTGCGGCAAGAACGCCCGATCAGCCGCCTGTCGGACACGCCGCGTTGCCTTCACAGGAAAGCTTCAGA
ATTGGCCAACGCGCGCATATGGCATTCGCGCCACGCGAAATCGCACAACTGAACTGGCGTGACGGCAAAG
TCAATCTGAACATTTTCGGTCCGGGCGTGTGGGGCGCACAAGGCGCAATGCCGCTCCATTTTACCGAGCT
GGCGTATAGCCGGATGGAGAATCACGATTATGCGCTGGCGGATTTTGTCGATCTGTTTCACCACCGGGCG
CTCTCACATTTTTATCGCGCCTGGTTTATTGCGCAGGATACCGCGACGCTTGACAGAACGGATGATGAAA
AATTTGCCTTTTATGTCGGCAGTCTTGCTGGTCTGGATCTTCAGGAAATTGCCCATTCTTGTCTTCCTGC
ACACGCCCGCCTGACCTCGTGCGCCCACCTTGTCCGTGAGGCCCGCAACCCCGAAGGGCTGCTTGGCGCC
CTGCAGGACTACTTTCAGGTACCTGTCCATATTAAAGAATTTGTTGGTCAGTGGATCCTGTTAGACCGCA
CCGATCAGACGCATCTGGGCAACGGCGACACCGCGATATTGCTCGGTAAAAGCGCGATTCTCGGCGAAAC
CGTACTGGATCGTCAGCATAAATTTCAGCTCATTATCGGGCCGCTTACTCTTGAGCAATACCTGCGTTTT
AGTCCCTGGGGTCAGGATCTCCCCGTTCTGAAAGAATGGGTACGCAATTTCATCGGTTTTGAATATGCCT
GGGAGGTGCAGTTGCTTCTCAAGGCACAGGAGGTGCCTTGTACCTCGCTGGATGGCACACATCAGCTTGG
TTATGCCAGCTGGCTTGCCAGAGAAGCGTCAATTAAACCGCTCCTCGGCATGTGTTTTGAGCCCGAGTTT
AAGCAGAACAACTGA