SecReT6
Protein ID: 260597002
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12100
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1264621..1266501 [-]
Producthypothetical protein
NoteTssF
UniProt IDC9XYK5
KEGG IDctu:CTU_12100
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-201, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|260597002|ref|YP_003209573.1| unnamed protein product [Cronobacter turicensis z3032]
MDNKFLDYYNKELTYMREMAQEFASRHPKIAARLGMHGLEIADPYVERLIEAFCFMSARMQIKLDAEFPL
FTQRLLDIIYPNYTSPIPSMGVVQLKPDLKEGDLTQGYVVPRSSAFYTPIAPGEATRCEFRSGHNVTLWP
LEIVEARLTSLPPDIPASAKFNLPLQRLKGALRIRLKLHDGLHFSQLSGFEQLPIYIDGDERVVSRIFEL
IHTANVAMMIRGKSHAGIEDTLVTEEPLAFEGLTPEQRLLPAQWNIFHGHTLLQEYFACRQRFYFFTLTQ
LSKGLKKIESNEAEIIILLDNAPQDLVSHITASRFLLFCTPVINLFPKQMDKVEINRALNEFHVVADRSR
PLDYEVFSINNVIGQQAETSNEVVFNPLFQTRHYHHGNAGRYFSYTRRPRTQEKSARHYETRTSYRGTEV
FISLVDQHEAPYGDAIRYLSVDALVTNRDLPALLSRTGNFELTMTDAAPVEGARFVCTPSVPQPPFAEDE
SAWRLIRQLSFNYQPLADMDHSPGGEALRKMLRLFVSQYDSEANTHIDALVGCKSEPVIRRLPDNGLLIY
GRGVRCTLTVDERGFSGISPYLFGLIMENYVARHAAINVFTETELVSMQRGRISCWKARPGRRGIL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|325295716|ref|NC_013282.2|:c1266501-1264621 Cronobacter turicensis z3032 chromosome, complete genome
ATGGATAATAAGTTTCTTGATTATTACAATAAAGAACTCACCTATATGCGGGAAATGGCGCAAGAATTCG
CATCACGCCACCCTAAGATCGCCGCACGTCTGGGTATGCATGGACTGGAAATAGCTGATCCTTATGTAGA
GCGTTTGATTGAAGCATTCTGTTTTATGTCAGCTCGTATGCAGATTAAACTGGATGCGGAATTTCCTTTA
TTTACGCAGCGTTTGCTGGATATTATTTATCCTAATTATACATCCCCGATTCCCTCTATGGGTGTGGTGC
AGCTGAAACCTGATTTGAAAGAAGGTGACTTAACGCAGGGCTATGTCGTGCCCCGAAGCAGTGCGTTCTA
CACCCCCATAGCTCCTGGCGAAGCAACCCGTTGTGAATTTCGAAGTGGCCATAACGTTACGCTCTGGCCA
CTGGAGATCGTTGAAGCCCGACTGACCTCTTTACCACCAGATATTCCCGCGTCTGCAAAATTCAATTTGC
CGCTACAGAGACTTAAAGGCGCGCTGCGTATCAGGCTCAAACTTCATGACGGCCTTCACTTTTCGCAACT
TAGCGGGTTTGAGCAACTTCCCATTTATATAGACGGAGATGAACGTGTCGTCTCACGCATCTTCGAGCTT
ATTCATACCGCGAATGTTGCGATGATGATTCGCGGGAAGTCGCATGCGGGAATCGAAGACACGCTTGTTA
CAGAAGAACCGTTAGCTTTCGAGGGCCTGACGCCTGAGCAGAGATTATTGCCTGCTCAATGGAATATTTT
TCATGGCCATACGCTGCTCCAGGAGTACTTTGCCTGCCGACAACGTTTTTACTTTTTTACGCTTACCCAG
TTAAGCAAGGGACTGAAAAAGATAGAAAGTAATGAAGCGGAGATCATTATTCTGCTGGATAACGCCCCGC
AGGATCTGGTCAGCCATATCACAGCTTCACGGTTTCTGCTGTTTTGTACGCCTGTGATTAACCTGTTTCC
TAAACAAATGGACAAGGTGGAAATTAACAGAGCATTAAATGAATTTCATGTCGTCGCCGATCGCAGCCGT
CCGCTGGATTACGAAGTCTTTTCCATCAATAACGTTATTGGACAGCAGGCGGAAACCAGTAACGAAGTGG
TATTTAATCCGCTGTTTCAGACTCGCCATTATCACCACGGCAATGCCGGGCGCTATTTTTCATACACCAG
ACGCCCCAGAACGCAGGAAAAGAGCGCCCGCCATTACGAAACGCGAACGTCATACCGGGGAACTGAGGTT
TTCATCTCGCTTGTCGACCAGCACGAAGCGCCCTATGGTGATGCCATCCGCTATTTATCTGTCGATGCGC
TGGTGACTAACCGCGATCTTCCCGCACTGCTTTCCCGTACGGGAAATTTTGAACTCACCATGACGGACGC
CGCCCCCGTTGAAGGCGCAAGATTTGTTTGTACGCCTTCCGTACCACAACCGCCTTTTGCCGAAGATGAA
TCAGCCTGGCGGCTGATTCGCCAGCTCAGTTTCAATTACCAGCCTCTGGCGGATATGGATCATAGTCCAG
GCGGAGAAGCGCTGCGTAAGATGCTGCGTTTGTTTGTCAGCCAATATGACAGCGAGGCCAACACTCATAT
AGATGCACTGGTAGGGTGTAAAAGCGAGCCGGTTATTCGCCGCCTGCCAGACAACGGCCTGCTTATTTAT
GGCAGAGGAGTCCGCTGCACGCTTACCGTTGACGAAAGGGGCTTCTCCGGTATTAGCCCGTATCTCTTTG
GGCTCATCATGGAAAATTACGTCGCCCGGCACGCCGCGATTAATGTTTTCACCGAAACGGAATTAGTCTC
TATGCAGCGAGGACGCATCAGCTGCTGGAAAGCGCGTCCCGGAAGACGGGGGATCCTGTAA