SecReT6
Protein ID: 260597003
SecReT6 ID363
T6SS typeN/A
Gene symbolclpB
Locus tagCTU_12110
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1266974..1269748 [+]
Productchaperone protein clpB
NoteTssH
UniProt IDC9XYK6
KEGG IDctu:CTU_12110
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 262..342
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 648..815
AAA [PF00004], Evalue: 1.20E-21, Aligned region: 263..394
AAA [PF00004], Evalue: 1.20E-21, Aligned region: 654..738
ClpB_D2-small [PF10431], Evalue: 1.50E-14, Aligned region: 564..594
ClpB_D2-small [PF10431], Evalue: 1.50E-14, Aligned region: 821..893
AAA_5 [PF07728], Evalue: 5.90E-13, Aligned region: 263..341
AAA_5 [PF07728], Evalue: 5.90E-13, Aligned region: 527..560
AAA_5 [PF07728], Evalue: 5.90E-13, Aligned region: 653..770
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 240..281
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 304..343
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 539..559
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 649..697
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 717..741
Sigma54_activat [PF00158], Evalue: 1.20E-08, Aligned region: 259..343
Sigma54_activat [PF00158], Evalue: 1.20E-08, Aligned region: 653..759
AAA_19 [PF13245], Evalue: 1.40E-08, Aligned region: 261..284
AAA_19 [PF13245], Evalue: 1.40E-08, Aligned region: 649..675
AAA_19 [PF13245], Evalue: 1.40E-08, Aligned region: 762..781
AAA_19 [PF13245], Evalue: 1.40E-08, Aligned region: 836..863
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 263..348
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 396..431
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 651..675
AAA_25 [PF13481], Evalue: 4.30E-07, Aligned region: 263..339
AAA_25 [PF13481], Evalue: 4.30E-07, Aligned region: 643..679
AAA_14 [PF13173], Evalue: 8.80E-06, Aligned region: 264..348
AAA_14 [PF13173], Evalue: 8.80E-06, Aligned region: 652..734
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 246..282
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 537..574
IstB_IS21 [PF01695], Evalue: 1.80E-05, Aligned region: 650..673
AAA_18 [PF13238], Evalue: 6.30E-05, Aligned region: 263..331
AAA_18 [PF13238], Evalue: 6.30E-05, Aligned region: 654..685
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 255..280
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 647..676
T2SE [PF00437], Evalue: 8.20E-05, Aligned region: 251..277
T2SE [PF00437], Evalue: 8.20E-05, Aligned region: 640..730
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 264..280
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 528..553
AAA_17 [PF13207], Evalue: 9.80E-05, Aligned region: 653..691
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 242..276
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 315..352
Arch_ATPase [PF01637], Evalue: 0.00023, Aligned region: 652..697
UPF0079 [PF02367], Evalue: 0.00032, Aligned region: 263..284
UPF0079 [PF02367], Evalue: 0.00032, Aligned region: 643..678
Zeta_toxin [PF06414], Evalue: 0.00036, Aligned region: 263..279
Zeta_toxin [PF06414], Evalue: 0.00036, Aligned region: 516..553
Zeta_toxin [PF06414], Evalue: 0.00036, Aligned region: 652..693
AAA_30 [PF13604], Evalue: 0.00078, Aligned region: 262..285
AAA_30 [PF13604], Evalue: 0.00078, Aligned region: 650..682
NTPase_1 [PF03266], Evalue: 0.0019, Aligned region: 263..285
NTPase_1 [PF03266], Evalue: 0.0019, Aligned region: 314..340
NTPase_1 [PF03266], Evalue: 0.0019, Aligned region: 653..674
NACHT [PF05729], Evalue: 0.0021, Aligned region: 263..291
NACHT [PF05729], Evalue: 0.0021, Aligned region: 653..675
TIP49 [PF06068], Evalue: 0.0051, Aligned region: 249..285
TIP49 [PF06068], Evalue: 0.0051, Aligned region: 653..688
DUF853 [PF05872], Evalue: 0.0096, Aligned region: 252..336
DUF853 [PF05872], Evalue: 0.0096, Aligned region: 527..588
DUF853 [PF05872], Evalue: 0.0096, Aligned region: 654..674
Protein Sequence: 924 a.a.     [Download]
>gi|260597003|ref|YP_003209574.1| clpB gene product [Cronobacter turicensis z3032]
MFFLYFLKKEMAQSGNQAAVLSGNYVKRKHHVTISRKNLFSKLGETLFRSIESATTFCKLRGNPYVELVH
WINQIWHQEDNDLKHIARYFNVDSEGLERGLSYSLERLPGSATAVSDFSYLIELAIERAWIYTSLERCEN
KIRSGHLLMALLTTVELRRALLAVAAPLEKVVLEQLSHDFDYITRHSPEVQERESPPFLSSQSAVPGEAS
GAIKLQSTGSLAQYSTDVTALAREGKIDPVLGRDREISTIIDILLRRRQNNPLLTGDAGVGKTAVVEGLA
CAISRGDVPPSLCDVRLLSLDIVALSAGASMKGEFEARLKAVLEEAASSEQPVILFVDEIHNLIGAGNSA
GTGDAANLLKPALARGQLRTIGATTWSEFKRHIEKDPALTRRFQVLQVEEPDENSATDMLRGMVPVLELH
HNVWILDEALRAAVKLSHRFIPSRQLPDKAISLLDTACARVAVGQHTPPYVLQELKYQIESANRQLSLAT
KASTFGKEDQASIDTLKSVIKLRSKEANSLESRWLQEKTSVSEIIAARATLQHLCQNEEVDRAEREALQQ
ALLEIEAQLNAIRHEQAMVHTEVSAEVVAAIVSEWTGIPVGQMLQDEMNIVRELPVRLAERVTGQTFALK
QISERILMARTGLADPVRPTGVFMLTGPSGTGKTETALAIAENMYGGEHNLITINMSEYQEAHTVSALKG
SPPGYVGYGEGGILTEAVRRKPYSVILLDEIEKAHPDVHELFFQVFDKGRMEDGEGRLIDFRNTIILLTS
NVGSEKISLLCRDENTVPDEEGLLTLLHNDLLKVFPAAFLGRVTVIPYLPLKSDALMLIVKMQLKRVANR
LYENHNVTLQYNDEAVRYIVEQCHVAETGARILIRYIEQKIIPKIGGILMDSALKARLLGVTIRTGTECL
LIEPYINDDIPEIN
 
Nucleotide Sequence: 2775 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1266974-1269748 Cronobacter turicensis z3032 chromosome, complete genome
TTGTTTTTTCTCTATTTTCTAAAAAAAGAAATGGCGCAATCTGGTAATCAGGCTGCAGTTCTTTCCGGAA
ACTATGTTAAGAGAAAACATCACGTGACTATCTCAAGGAAGAATCTTTTTTCAAAGCTGGGCGAAACGCT
TTTCAGAAGCATTGAAAGCGCAACGACCTTTTGTAAGTTACGTGGCAATCCTTATGTTGAACTGGTTCAC
TGGATTAATCAGATCTGGCACCAGGAGGACAACGATTTAAAACACATCGCACGTTACTTTAATGTTGACA
GCGAAGGGCTGGAGCGTGGGTTAAGTTATTCCCTTGAACGTTTGCCTGGTAGCGCGACGGCGGTTTCTGA
TTTCTCTTATCTTATTGAACTCGCTATTGAACGTGCCTGGATATATACCAGCCTAGAGCGTTGTGAAAAT
AAAATACGCAGCGGCCATCTTTTAATGGCTCTTCTTACCACTGTCGAGTTGCGCCGCGCGTTACTGGCGG
TGGCTGCTCCTCTTGAGAAAGTGGTTCTTGAACAACTCAGTCATGATTTTGACTATATAACCCGTCATTC
ACCTGAGGTACAGGAAAGAGAATCACCCCCTTTTCTCAGCAGCCAAAGCGCCGTGCCAGGTGAAGCCAGC
GGGGCTATCAAGCTCCAAAGTACCGGAAGCCTTGCGCAATATTCGACCGATGTGACTGCGCTTGCCAGGG
AAGGGAAAATTGATCCTGTGCTGGGACGCGATCGCGAAATTAGCACGATTATCGATATCCTGTTACGCCG
CCGTCAAAACAATCCCCTACTCACCGGCGATGCTGGCGTTGGTAAAACTGCCGTTGTTGAAGGACTGGCA
TGCGCTATTAGCCGCGGCGATGTTCCTCCGTCGCTCTGCGATGTGCGCTTATTAAGCTTAGATATTGTGG
CTCTTTCTGCGGGCGCCAGTATGAAAGGGGAGTTTGAAGCTCGCCTTAAAGCTGTGCTGGAAGAGGCTGC
ATCATCCGAACAGCCCGTTATTTTATTTGTTGATGAAATACATAATCTGATTGGGGCCGGTAATAGTGCA
GGTACTGGCGATGCGGCAAACCTGCTGAAGCCAGCGTTAGCCCGGGGTCAATTACGGACTATCGGAGCAA
CGACCTGGAGCGAATTTAAACGCCATATCGAAAAGGATCCGGCACTCACGCGTCGGTTCCAGGTTTTGCA
GGTGGAAGAGCCGGATGAAAACAGCGCTACAGATATGTTGCGTGGGATGGTACCGGTGCTCGAATTGCAT
CATAACGTCTGGATTTTGGATGAAGCATTGCGCGCCGCCGTTAAACTTTCGCATCGTTTTATCCCTTCGC
GTCAGCTGCCGGATAAAGCCATCAGCCTGTTAGATACAGCCTGTGCAAGGGTAGCTGTTGGGCAGCATAC
GCCGCCGTACGTACTGCAGGAGTTAAAATATCAAATTGAATCTGCAAACAGGCAGCTTTCGCTAGCTACC
AAAGCCAGTACGTTCGGGAAGGAAGATCAAGCCTCTATCGATACATTAAAAAGCGTTATTAAGCTGAGGT
CCAAAGAGGCTAATTCCCTTGAGTCGCGTTGGCTCCAGGAAAAGACGAGTGTCAGTGAAATTATCGCTGC
CCGGGCGACGTTGCAGCATCTTTGCCAGAATGAAGAGGTCGATCGCGCAGAGCGGGAGGCATTACAGCAA
GCGCTTTTAGAGATAGAGGCTCAGCTTAATGCGATTCGTCATGAGCAGGCGATGGTTCACACTGAAGTCA
GTGCAGAAGTCGTTGCTGCGATTGTCAGCGAATGGACCGGTATTCCGGTAGGCCAGATGCTGCAGGATGA
AATGAATATTGTCCGTGAACTTCCTGTGCGCCTTGCCGAACGCGTTACTGGCCAGACTTTTGCTCTGAAA
CAGATCAGCGAACGCATTTTAATGGCACGGACAGGGTTAGCCGATCCTGTACGTCCCACAGGCGTCTTTA
TGCTCACCGGACCATCCGGGACGGGGAAGACCGAGACCGCGTTGGCCATTGCGGAAAATATGTATGGTGG
TGAGCATAATCTTATCACCATCAATATGAGTGAATATCAGGAAGCGCATACAGTTTCAGCGTTAAAAGGA
TCGCCGCCCGGGTATGTGGGTTACGGTGAAGGAGGGATCCTTACGGAGGCTGTTCGCCGTAAACCATACA
GCGTTATTCTGCTGGATGAGATCGAAAAAGCGCATCCTGATGTTCATGAGCTTTTTTTCCAGGTATTTGA
TAAAGGGCGTATGGAAGATGGTGAGGGTCGATTAATCGATTTTCGCAATACCATCATATTATTAACCAGC
AATGTCGGTAGTGAAAAAATTAGCCTGTTATGCCGTGATGAGAATACTGTACCTGATGAGGAAGGCTTAC
TAACGCTCTTGCATAATGATTTATTAAAAGTGTTTCCTGCTGCTTTTCTCGGAAGGGTGACGGTAATCCC
TTATCTGCCGCTAAAAAGCGATGCGCTGATGCTTATCGTGAAGATGCAGCTTAAGCGAGTGGCGAATCGC
CTGTATGAAAACCATAACGTAACGCTTCAATATAATGATGAGGCCGTAAGATATATTGTTGAACAATGTC
ATGTGGCCGAAACCGGTGCGCGGATATTAATTCGTTATATAGAGCAAAAGATTATACCAAAAATAGGAGG
GATTCTTATGGATAGCGCTCTTAAAGCAAGGCTTTTGGGCGTGACGATTAGAACAGGAACAGAATGTCTC
CTGATTGAACCTTATATCAATGATGACATTCCTGAAATAAATTAA