SecReT6
Protein ID: 260597008
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12160
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1275122..1276624 [+]
Producthypothetical protein
NoteTssC
UniProt IDC9XYL1
KEGG IDctu:CTU_12160
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-193, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|260597008|ref|YP_003209579.1| unnamed protein product [Cronobacter turicensis z3032]
MSMSQTQQSHNAAASAVEIDDFNALLAREFKPRSDQTRSAVEGAVKTLAEQALVNAVTLSDDAYKCIASI
IAEIDRKLSEQINLILHHDEFQTLESAWRGLHYLVTHTETDEKLKLRFLDISKTDLRRTMKRYKGVAWDQ
SPLFKKVYEEEYGQLGGEPYGCLVADYYFDHSAPDVDLLASLAKVAASAHVPFITGASPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRLAEDSRYIGLAMPRFLARLPYGIRTNPVDEFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDADATANANLSARLPYMFACSRFAHYLKCIVRDKIGTFKERD
DMQRWLNDWIMNYVDADPTNSSLETKSRRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKHVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1275122-1276624 Cronobacter turicensis z3032 chromosome, complete genome
ATGTCTATGAGTCAAACACAGCAATCCCACAACGCCGCTGCGTCTGCCGTTGAAATCGATGATTTTAATG
CGCTGCTTGCAAGAGAATTTAAACCACGTTCGGATCAGACTCGCTCTGCCGTTGAAGGGGCCGTCAAAAC
GCTGGCGGAGCAGGCGCTGGTTAATGCCGTCACGCTATCTGATGATGCCTACAAGTGCATTGCATCAATC
ATTGCGGAAATTGACAGAAAACTCTCTGAGCAAATCAACCTTATTTTACATCACGACGAGTTTCAGACGC
TGGAGAGCGCCTGGCGTGGCCTGCATTATCTGGTCACCCATACTGAAACAGACGAAAAGTTAAAGTTACG
CTTTCTGGATATTTCCAAAACCGACCTGCGCCGTACGATGAAACGCTATAAAGGCGTCGCATGGGATCAG
AGCCCGCTATTTAAAAAAGTCTATGAAGAAGAGTACGGGCAGTTGGGCGGCGAGCCCTACGGCTGTCTGG
TTGCCGATTATTATTTCGATCACAGCGCGCCTGATGTCGATCTCCTGGCCTCGCTCGCTAAAGTGGCGGC
CTCTGCGCATGTTCCCTTTATTACCGGCGCTTCGCCATCCGTGCTGCAGATGGAATCCTGGCAGGAGCTT
TCCAACCCTCGCGATCTGACAAAAATCTTCACGCAGAATCTTGAGTATGCGGCCTGGAATTCACTGCGCC
TGGCGGAAGATTCTCGCTATATCGGTCTTGCCATGCCGCGTTTCCTGGCCCGTTTGCCCTACGGCATTCG
CACCAATCCGGTTGACGAGTTTCATTTTGAAGAAACGACTGACGGCGCAGACCATTCAAAATATGTCTGG
TCAAATGCCGCCTATGCGATGGCTGTTAATATCAACCGTTCCTTTAAAGAATATGGCTGGTGTACGCTCA
TTCGCGGCGTTGAAAGCGGCGGTGTCGTGGAAGGGTTGCCGTGCCATACCTTCCCGACAGACGATGGCGG
CATTGACATGAAGTGCCCGACGGAAATTGCTATATCTGATCGTCGCGAAGCTGAGCTCGCCAAAAATGGT
TTTATTCCGCTCGTGCATCGTAAAAATACGGATTATGCCGCTTTTATTGGCGCACAGTCTTTGCAAAAAC
CTGCTGAATATTATGATGCAGACGCTACTGCCAATGCGAATTTATCGGCGCGTTTACCCTATATGTTCGC
CTGCTCGCGTTTTGCGCATTATTTGAAATGTATCGTTCGCGATAAAATCGGTACTTTTAAAGAGCGCGAC
GATATGCAGCGCTGGCTGAATGACTGGATCATGAATTATGTCGACGCCGATCCCACTAACTCATCGTTAG
AAACGAAATCGCGCCGTCCGCTCGCCGCCGCGGAAGTTATTGTGGAGGATGTGGAAGGAAATCCGGGTTA
TTACCAGGCGAAATTCTTTTTACGTCCTCATTTCCAGCTTGAAGGCTTAACGGTGTCATTACGCATGGTC
GCGAAACTGCCGTCGTTGAAACATGTTGCCTGA