SecReT6
Protein ID: 260597010
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12180
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1277481..1277984 [+]
Producthypothetical protein
NoteTssJ
UniProt IDC9XYL3
KEGG IDctu:CTU_12180
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-30, Aligned region: 7..150
Protein Sequence: 167 a.a.     [Download]
>gi|260597010|ref|YP_003209581.1| unnamed protein product [Cronobacter turicensis z3032]
MFIALGMISACRSTPPDAKENKVALTLVAGANMNPNVRGVASPLKVFVYALTHDEAFLDAGYLTITGSPD
PELKKEMHQLWEGILRPGETKHITVAVDDTTHALGIVAAYRDIQKAQWSETYRLTEKQPPAWYQSLWPWQ
TEAPAPTVNVSFDKLHITINGLNRENE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1277481-1277984 Cronobacter turicensis z3032 chromosome, complete genome
CTGTTTATCGCGCTGGGCATGATATCGGCGTGTCGGTCCACACCGCCCGACGCCAAAGAAAATAAGGTAG
CGCTAACACTGGTTGCTGGCGCGAATATGAATCCGAATGTGCGTGGCGTGGCGAGTCCGCTGAAAGTTTT
TGTTTATGCGCTTACTCACGATGAAGCGTTTCTGGACGCGGGTTACCTGACGATTACCGGTTCACCCGAT
CCTGAATTAAAAAAAGAGATGCATCAATTATGGGAAGGCATTTTACGCCCGGGTGAGACAAAGCACATCA
CCGTCGCGGTGGACGATACGACTCATGCGCTCGGCATTGTTGCCGCTTATCGGGACATTCAAAAGGCGCA
GTGGAGCGAGACGTATCGCCTGACTGAAAAGCAGCCGCCCGCCTGGTATCAGTCGCTCTGGCCATGGCAG
ACCGAGGCGCCAGCGCCAACTGTCAACGTCAGCTTCGATAAATTACATATCACTATCAATGGATTGAACC
GTGAGAACGAATAA