SecReT6
Protein ID: 260597011
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12190
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1277971..1279317 [+]
Producthypothetical protein
NoteTssK
UniProt IDC9XYL4
KEGG IDctu:CTU_12190
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-140, Aligned region: 19..447
Protein Sequence: 448 a.a.     [Download]
>gi|260597011|ref|YP_003209582.1| unnamed protein product [Cronobacter turicensis z3032]
MRTNKVIWSEGLFLRPQLFQQQERYLEYFSHKRAATITPFFWGFSRYSIDKEALAYGKLVLHSGSGVFPD
GTPFDIPEHVSPPEPLTIRPEHLGQRLFLAVPLRLDNSDETIFDEHDVSSLARFCAFETQLTDANAIRQG
PKPVQMGRLRLMLTPESEMTESWIGLPLARIRAIQPDGSVLLHEQDYIPPVTSCAASALLVEWVTHLNGL
VKLRAEMLAGRLSNSDGKASASAEIVDYLLLQIFNKYEPVLDHLRHVPELPPIALYQELAKFAGELSTFI
RTKTRRPRPAPGYDHAQLYPSIRPLVDDVHELLNQILIRAGQIIPLHAKGNGVWSAAVLPGELRTFSNLV
LAVNAQLPADVLQQHFSAQVKISAPQQLHELVRSHLPGLELLALPVPPRQIPYNAGHVYFELQKSGAFWE
AIAVTGALAMHVAGEFPGLKMELWGIRD
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1277971-1279317 Cronobacter turicensis z3032 chromosome, complete genome
GTGAGAACGAATAAAGTCATTTGGAGTGAAGGTCTGTTTTTACGCCCGCAACTGTTTCAGCAGCAGGAGC
GTTATCTGGAATATTTCTCGCATAAGCGAGCCGCCACCATAACTCCCTTTTTCTGGGGTTTTTCGCGTTA
CAGCATTGATAAAGAAGCGCTCGCCTATGGCAAGCTCGTTCTGCATTCGGGCAGCGGCGTTTTCCCCGAC
GGCACGCCTTTCGATATTCCGGAGCATGTTTCTCCACCGGAGCCGTTAACGATCCGTCCCGAGCATTTAG
GGCAACGACTCTTTCTGGCCGTGCCGCTGCGGCTTGATAACAGCGATGAAACCATTTTTGATGAGCACGA
TGTCAGTTCGCTTGCGCGCTTTTGTGCCTTTGAAACGCAGCTGACCGACGCCAATGCTATTCGTCAGGGG
CCAAAGCCGGTCCAGATGGGGCGTCTTCGCCTGATGCTGACGCCTGAAAGCGAGATGACGGAGTCCTGGA
TTGGTTTGCCGCTGGCACGCATTCGCGCCATCCAGCCGGATGGCAGCGTGTTATTGCATGAACAGGACTA
TATCCCGCCGGTCACCAGCTGCGCGGCGAGCGCGCTGCTTGTTGAATGGGTAACGCATCTTAACGGGCTC
GTTAAATTGCGCGCCGAAATGCTGGCAGGCAGGCTCTCGAATAGCGATGGCAAAGCCAGCGCCAGCGCGG
AAATCGTCGATTACCTGTTGCTGCAAATCTTTAATAAATACGAACCGGTGTTGGATCATCTGCGTCACGT
ACCGGAGCTCCCGCCGATTGCCCTGTATCAGGAGCTGGCGAAGTTCGCCGGTGAATTGTCCACTTTTATT
CGCACCAAAACGCGGCGACCGCGACCAGCGCCAGGCTATGACCATGCGCAGTTGTACCCCAGCATTCGGC
CGTTAGTCGATGATGTTCATGAGTTACTGAATCAAATATTGATTCGCGCCGGGCAGATTATTCCTCTGCA
TGCGAAAGGTAATGGTGTCTGGAGCGCGGCGGTTCTGCCTGGTGAACTGCGTACTTTCTCAAACCTGGTA
CTGGCGGTGAATGCGCAACTGCCGGCTGATGTTTTACAACAGCATTTTTCCGCACAGGTAAAAATTAGCG
CGCCTCAGCAGTTGCATGAACTGGTGCGGTCGCATTTGCCCGGTCTTGAGCTGCTGGCGCTCCCGGTACC
GCCGCGACAGATCCCCTATAACGCAGGGCATGTCTATTTCGAGCTACAAAAAAGCGGCGCCTTCTGGGAG
GCCATCGCGGTTACCGGCGCGCTGGCCATGCATGTTGCCGGTGAATTCCCTGGTCTCAAAATGGAGTTGT
GGGGGATCCGTGACTGA