SecReT6
Protein ID: 260597012
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12200
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1279386..1280660 [+]
Producthypothetical protein
NoteTssL
UniProt IDC9XYL5
KEGG IDctu:CTU_12200
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-55, Aligned region: 22..42
DUF2077 [PF09850], Evalue: 3.50E-55, Aligned region: 52..257
OmpA [PF00691], Evalue: 7.60E-17, Aligned region: 318..416
Protein Sequence: 424 a.a.     [Download]
>gi|260597012|ref|YP_003209583.1| unnamed protein product [Cronobacter turicensis z3032]
MDEQNGLFDSQAAFTDPLNSEKESASAWRSHARLKTESIQQRVAKVRAAQIPLLEAALPLLRALSEMPES
IPAVRDVESLKDILKHEITVFGVVCDEADIPWKKMAIVRYCLCTALDEAAHATRWGIQSGWSQSNLLNHF
EGDNDGGNKFFLLVGRLSASPHEFPDVLEIMLHILGLGFEGRYSIIDDGERQLTRIRQRLLTLIQSTRET
LPPALSPHAYCDGHASRRQVFFLPVRVSLAVCSFLVVALFLGCKYYLSMPQESFRQQLLAMQRLPVTEPR
PAERLRLAVLLKEEIARHWVSVDESPRESRVIFHGDSMFSSGAAIVRPDRVDIIRRVAAEVRRVDGAVVI
IGHTDSTPIRSGAFASNQALSEKRAEAVAAYFLAQGIAPEKITPKGAGDTQPIASNHDEKGRSQNRRVEI
FVTY
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1279386-1280660 Cronobacter turicensis z3032 chromosome, complete genome
GTGGATGAGCAAAACGGTTTGTTCGATTCACAGGCGGCTTTTACTGACCCTTTAAATAGCGAAAAAGAAA
GCGCTTCGGCGTGGCGTTCTCACGCCCGCCTCAAAACGGAGAGCATTCAACAGCGCGTCGCAAAAGTGCG
CGCCGCGCAAATTCCGTTGCTGGAAGCCGCCCTGCCACTGTTACGCGCGCTCAGTGAAATGCCAGAAAGC
ATTCCGGCGGTTCGTGACGTTGAATCACTTAAAGATATCCTGAAGCATGAAATCACGGTTTTTGGGGTGG
TCTGCGATGAGGCCGATATTCCCTGGAAAAAAATGGCCATTGTGCGCTATTGCCTGTGCACGGCGCTGGA
TGAGGCGGCCCATGCAACGCGCTGGGGCATTCAGTCAGGCTGGTCGCAGAGCAATTTGCTCAACCACTTC
GAAGGGGACAACGATGGCGGGAATAAATTCTTCCTGCTGGTGGGCAGGCTTTCTGCCAGTCCACATGAAT
TTCCCGATGTGCTCGAAATCATGTTGCATATCCTGGGGCTGGGTTTCGAAGGGCGCTACAGCATCATTGA
CGATGGCGAGCGTCAACTGACCCGTATTCGTCAGCGGCTCTTAACGCTGATACAGAGCACGCGCGAGACG
CTTCCTCCGGCGCTTTCCCCTCATGCTTATTGCGACGGCCATGCATCGCGCCGACAGGTTTTCTTTCTGC
CGGTACGGGTGTCGCTGGCTGTCTGTAGTTTTCTGGTCGTCGCGCTGTTTCTGGGCTGCAAATATTACCT
TTCGATGCCGCAGGAGTCATTCAGGCAACAGCTTCTGGCGATGCAGCGTTTGCCTGTTACCGAGCCTCGT
CCGGCAGAGCGGCTACGCCTTGCCGTCCTGCTTAAAGAAGAGATTGCCCGCCACTGGGTCAGCGTGGATG
AGTCGCCGCGGGAAAGTCGGGTCATCTTTCATGGCGATTCCATGTTTTCGTCAGGCGCGGCCATCGTCAG
ACCGGATCGCGTCGACATTATTCGCCGCGTTGCCGCTGAAGTGCGGCGGGTGGATGGCGCGGTGGTGATT
ATCGGCCATACCGATTCCACGCCCATACGCAGCGGGGCCTTTGCCAGTAATCAGGCGCTGTCGGAAAAGC
GGGCGGAGGCGGTTGCCGCTTATTTCCTGGCCCAGGGCATTGCGCCTGAAAAAATCACGCCCAAAGGTGC
CGGAGACACGCAGCCGATTGCCAGTAATCACGATGAGAAGGGACGCTCGCAAAACCGACGCGTTGAAATT
TTTGTGACCTATTAA