SecReT6
Protein ID: 260597015
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12230
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1285170..1287671 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9XYL8
KEGG IDctu:CTU_12230
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-78, Aligned region: 29..349
Phage_base_V [PF04717], Evalue: 2.50E-26, Aligned region: 386..479
SOBP [PF15279], Evalue: 0.0088, Aligned region: 694..720
SOBP [PF15279], Evalue: 0.0088, Aligned region: 738..830
Protein Sequence: 833 a.a.     [Download]
>gi|260597015|ref|YP_003209586.1| unnamed protein product [Cronobacter turicensis z3032]
MSRTTQLSSPAMPFLAGEPGLVLSKLTGEEALSTLYTYTLSAKTPASAAISWQAASNIDFKALVGKEMTV
VMEIDGSGLDEEAGTGRGRREISGLVERARYTGRDANQAMFEIELRPWLYLATLTSDFKIFQNKNVVEII
DEVLADYAFPCEKRLSGTYPPLDFQVQYGETDFSFIQRLMEEWGIYWFFEHKDEKHRLILVDHVGAHKRA
ESQAYHVLHYLPETPKAGEEYISHFTAQETITTGRWVTNDYDFTKSRADILSLDSKPRNTSFNQMEIYHW
PGDYAQPGIGEQLARVRMEERGALGSRATGEGELRGVVCGCNFVLSGYPVAKANREYLVIASRLEIEDNA
QVSGYEDYRWHCHFLVQPTSKIYRHPLQTPRPRTRGPQTAIVVGPPGEEVWTDKYGRVKVRFVWDRYGKN
RESDSCWLRVSQSWAGNNFGGMYIPRIGHEVIVDFINGDPDRPLIIGSLYNNITMPPWDLPGNATQSGMV
SRTIGGGRTNFNGIRFEDKPGLEQYWEQAERNMDRLTKKDETQTIGENSKLSVGLNRDVFIGANYVKKIL
GSCRKLIGLGAFMQVGLTREVMVGGAQAHHIGGANSLNVGGADLTNVGGYSGTSVGGAWQVAAGGAATVA
AGGAMSLSAGGVLTITANTIKIIGSSQVVIQGGQVQLNPGDGGCSGGNGSGGGMGALASLAGLMPLMGIM
VLPLPLPVLPIPVPIPVPIPTHSPTEAPTDTPTQTPTESPTETPTETETPTETPTETPTETPTETPTETP
TETPTETPTETPTETPTETPTETPTETPTETPTESPTETPTETPTETPTETPTETETVPPNLW
 
Nucleotide Sequence: 2502 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1285170-1287671 Cronobacter turicensis z3032 chromosome, complete genome
ATGTCGCGTACAACGCAATTAAGCAGTCCGGCAATGCCTTTTCTTGCCGGTGAACCGGGATTAGTTCTTT
CTAAATTAACCGGAGAAGAAGCGCTTTCCACGTTATATACCTACACCCTGAGCGCTAAAACGCCCGCCAG
TGCCGCCATCTCCTGGCAGGCGGCGTCAAATATCGATTTCAAAGCCCTGGTGGGTAAAGAAATGACGGTT
GTGATGGAAATCGACGGCAGCGGGCTGGATGAAGAGGCGGGCACTGGCCGGGGGCGGCGCGAAATATCGG
GGCTGGTAGAGCGCGCCCGTTATACCGGGCGTGACGCGAATCAGGCGATGTTTGAAATAGAACTCCGGCC
CTGGCTATATCTCGCAACGCTCACCAGCGACTTCAAAATTTTTCAAAATAAAAACGTGGTAGAAATTATC
GATGAGGTGCTCGCAGATTATGCTTTTCCCTGTGAGAAGCGTCTGAGCGGCACCTATCCGCCGCTCGATT
TTCAGGTGCAATATGGCGAAACGGATTTCAGTTTTATCCAGCGCTTAATGGAAGAGTGGGGCATTTACTG
GTTTTTTGAACACAAAGACGAGAAACACCGATTAATTCTGGTCGATCATGTGGGCGCGCATAAACGCGCT
GAAAGTCAGGCCTATCACGTTCTGCATTATTTACCCGAAACGCCCAAAGCGGGCGAAGAGTATATTTCTC
ATTTTACGGCGCAGGAAACGATTACTACCGGGCGCTGGGTAACCAATGATTACGATTTTACGAAGTCCCG
CGCGGATATTTTGTCTCTCGACAGCAAACCGCGAAATACCAGTTTTAACCAGATGGAGATCTATCACTGG
CCGGGTGATTACGCGCAGCCGGGCATTGGCGAACAGCTGGCGCGCGTGCGTATGGAAGAGCGCGGCGCGC
TGGGCTCACGCGCGACAGGCGAAGGCGAGCTCAGAGGCGTCGTCTGCGGCTGTAATTTTGTCTTAAGCGG
TTATCCCGTCGCGAAAGCCAACCGGGAATATCTGGTGATAGCCAGCCGCCTTGAGATAGAGGATAACGCG
CAGGTCAGCGGCTATGAAGATTATCGCTGGCATTGTCATTTTCTTGTTCAGCCGACCAGTAAAATCTACC
GGCATCCGCTGCAAACGCCCAGGCCGCGCACACGCGGGCCGCAGACGGCGATTGTCGTCGGGCCGCCTGG
CGAAGAGGTCTGGACGGATAAATATGGCCGCGTGAAAGTGCGCTTTGTCTGGGATCGCTACGGTAAAAAC
CGCGAATCGGATTCCTGCTGGCTGCGCGTCAGTCAGTCGTGGGCGGGTAATAACTTTGGCGGCATGTATA
TCCCGCGTATCGGGCATGAGGTCATTGTCGATTTTATTAATGGCGATCCGGATCGGCCTCTGATCATCGG
CAGTCTGTATAACAACATCACGATGCCGCCCTGGGATCTGCCTGGCAATGCGACGCAGAGCGGGATGGTC
AGCCGTACTATCGGCGGCGGGCGAACCAACTTCAACGGCATTCGCTTCGAGGATAAACCCGGTCTTGAGC
AGTACTGGGAGCAGGCTGAGCGCAATATGGATCGTCTGACGAAAAAAGATGAAACCCAGACGATTGGTGA
AAACTCAAAACTTTCCGTGGGCCTGAACCGGGATGTTTTCATCGGTGCGAATTACGTTAAAAAAATTCTC
GGTAGCTGCCGCAAACTGATTGGGCTTGGCGCATTTATGCAGGTCGGGCTGACGCGTGAGGTGATGGTTG
GCGGGGCGCAGGCGCATCACATTGGCGGCGCGAATTCCCTTAACGTCGGCGGCGCGGATTTAACAAACGT
CGGCGGCTACAGCGGCACCTCGGTCGGCGGCGCGTGGCAGGTGGCGGCGGGCGGCGCGGCGACAGTAGCG
GCGGGCGGGGCGATGTCGTTAAGCGCCGGTGGGGTGCTGACTATCACCGCCAACACCATCAAAATCATCG
GCAGCAGCCAGGTGGTGATACAGGGCGGGCAGGTTCAGCTCAACCCCGGCGACGGGGGGTGCTCCGGCGG
TAACGGCAGCGGTGGCGGTATGGGCGCGCTGGCGAGTCTGGCGGGTCTGATGCCGCTGATGGGCATTATG
GTGTTACCGCTTCCGCTGCCGGTACTGCCCATTCCTGTCCCTATCCCGGTACCGATCCCGACGCATAGTC
CAACCGAAGCGCCTACAGACACGCCGACACAAACGCCTACTGAAAGCCCGACGGAGACGCCGACCGAAAC
GGAAACGCCAACAGAAACGCCGACCGAAACGCCAACAGAAACGCCAACAGAAACGCCAACGGAAACGCCA
ACAGAAACACCAACGGAAACACCAACAGAAACACCAACGGAAACACCAACGGAAACACCAACGGAAACAC
CAACGGAAACACCAACGGAAACGCCGACCGAAAGTCCGACGGAGACGCCAACCGAAACGCCAACGGAGAC
CCCAACCGAAACGCCAACGGAGACGGAAACTGTGCCGCCCAATCTATGGTAA