SecReT6
Protein ID: 260597018
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12260
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1288788..1289579 [+]
Producthypothetical protein
NoteTagJ
UniProt IDC9XYM1
KEGG IDctu:CTU_12260
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.70E-41, Aligned region: 143..262
Protein Sequence: 263 a.a.     [Download]
>gi|260597018|ref|YP_003209589.1| unnamed protein product [Cronobacter turicensis z3032]
MEITLKELLNHAAFQAHLTEAISRVKAQPDNSAARELLFKLYCIEGDWHNALAQLEIVKLLDTEYTKRAE
LYKNLVMSELLRARVLAGDMAPVGLEAQMPDWVARLHDANQRLAAGDEADAERLRQQAFEMAPLTPGDGD
GVAPFSWIADGDGRLGPVCEFICAGGYRWVPFAALRELKILRPVDILDLLWLPAQATLADGQFQGYIPAR
YPLMTDATQETKLGSLTDWQRISDSLWIGRGRKMLITDKAEYALPDIRELRFD
 
Nucleotide Sequence: 792 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1288788-1289579 Cronobacter turicensis z3032 chromosome, complete genome
ATGGAAATAACACTTAAGGAATTACTGAATCACGCCGCGTTTCAAGCCCACTTAACAGAGGCAATTTCTC
GTGTAAAAGCGCAGCCTGACAACAGCGCGGCGCGAGAGCTGCTGTTCAAATTGTACTGTATTGAAGGCGA
CTGGCATAACGCCCTGGCGCAGCTGGAAATAGTAAAGCTGCTGGACACGGAATATACGAAGCGTGCGGAG
CTTTATAAGAATCTCGTCATGAGCGAGCTATTACGAGCCCGCGTTCTGGCCGGTGACATGGCGCCTGTGG
GGCTGGAGGCGCAGATGCCGGACTGGGTAGCGCGGCTGCATGACGCGAATCAACGGCTCGCCGCAGGCGA
TGAGGCGGACGCCGAACGCCTGCGTCAACAGGCGTTTGAGATGGCGCCGCTGACGCCGGGCGATGGCGAT
GGCGTCGCGCCGTTTAGCTGGATAGCCGACGGTGATGGACGGCTCGGGCCGGTATGCGAGTTCATCTGCG
CGGGCGGGTATCGTTGGGTGCCGTTTGCGGCGCTGCGCGAACTTAAAATCCTCCGCCCCGTTGATATACT
GGATCTGCTCTGGCTGCCGGCGCAGGCGACGCTCGCTGACGGACAATTTCAGGGTTATATCCCCGCCCGC
TACCCGCTGATGACGGACGCCACGCAGGAAACGAAACTGGGCAGCCTGACCGACTGGCAGCGCATTTCCG
ATTCGCTCTGGATCGGACGCGGCAGGAAGATGCTGATTACCGATAAGGCGGAATATGCTCTGCCGGATAT
CCGCGAACTGCGGTTTGATTAA