SecReT6
Protein ID: 260597019
SecReT6 ID363
T6SS typeN/A
Gene symbol-
Locus tagCTU_12270
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]1289589..1290071 [+]
Producthypothetical protein
NoteTssE
UniProt IDC9XYM2
KEGG IDctu:CTU_12270
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-15, Aligned region: 33..139
Protein Sequence: 160 a.a.     [Download]
>gi|260597019|ref|YP_003209590.1| unnamed protein product [Cronobacter turicensis z3032]
MERKKQFAPTLLDRLLDEEPKARHEAHDASFISARHYRQRVLRDIDILLNNTNIEALIDPERHPAVIDSV
INHGLAPLSGKYATPHSGSAVEQAIRNALLRFEPRIIASSLVVRPKRQPAVGTTLLFEIAALLYWQPEPI
GLTVSGSYDTETEKTTLTAL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|325295716|ref|NC_013282.2|:1289589-1290071 Cronobacter turicensis z3032 chromosome, complete genome
ATGGAGAGAAAAAAGCAATTCGCGCCGACGCTGCTGGACCGGCTGCTGGACGAGGAGCCGAAAGCCCGCC
ACGAGGCGCATGACGCGAGCTTTATCAGCGCCAGGCATTACCGTCAGCGGGTACTGCGCGATATCGACAT
CTTGCTTAACAATACCAATATTGAGGCGCTGATCGATCCTGAACGTCACCCGGCTGTCATCGACTCGGTG
ATAAACCACGGCCTGGCGCCATTATCCGGGAAATACGCCACGCCGCACAGCGGGTCTGCGGTGGAGCAGG
CCATTCGCAACGCCTTGCTGCGCTTTGAGCCGCGCATCATCGCGTCGTCGCTGGTGGTGCGCCCGAAACG
TCAGCCAGCCGTTGGCACCACGTTGCTCTTTGAAATAGCCGCGTTGCTTTACTGGCAGCCTGAGCCGATC
GGGCTGACGGTGAGTGGTAGTTATGATACCGAAACGGAAAAAACAACGCTGACGGCGTTATAA