SecReT6
Protein ID: 260597720
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19280
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2019540..2020037 [+]
Producthypothetical protein
NoteTssB
UniProt IDC9Y2X7
KEGG IDctu:CTU_19280
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|260597720|ref|YP_003210291.1| unnamed protein product [Cronobacter turicensis z3032]
MSGSFQEEIPKARINLKLNLHTGGAQKKVELPLKLLVTGDFSNGQETDPLSERKKIDVNKNNFDSVLCEF
APVVNLAVENTLAGNGCEENVRLTFRQMKDFEPEQVARQIPQLKAMLAMRNLLRDLKSNLLDNATFRKEL
ETILKDPALSDGLRAELASLAPKNA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2019540-2020037 Cronobacter turicensis z3032 chromosome, complete genome
ATGTCTGGTTCATTTCAGGAAGAAATTCCTAAAGCCCGTATTAATCTCAAATTAAACCTGCACACTGGCG
GCGCTCAGAAAAAAGTAGAGCTTCCGCTGAAATTATTAGTCACCGGCGATTTCAGTAACGGCCAGGAAAC
AGACCCGCTTTCCGAACGTAAAAAAATCGACGTCAATAAGAATAATTTTGACAGTGTGCTTTGCGAATTT
GCGCCTGTCGTGAATCTGGCCGTGGAAAATACGTTGGCGGGTAACGGGTGCGAAGAAAACGTGCGCCTGA
CATTCCGCCAGATGAAAGATTTTGAACCGGAGCAGGTGGCGCGGCAAATTCCCCAGCTTAAAGCCATGCT
CGCGATGCGCAATTTACTGCGCGACCTTAAATCGAATCTGCTTGATAACGCCACCTTCCGAAAAGAGCTG
GAAACCATCTTAAAAGATCCGGCGCTGAGCGATGGCTTACGCGCGGAACTGGCTTCGCTGGCCCCGAAAA
ACGCCTGA