SecReT6
Protein ID: 260597721
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19290
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2020072..2021613 [+]
Producthypothetical protein
NoteTssC
UniProt IDC9Y2X8
KEGG IDctu:CTU_19290
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.50E-174, Aligned region: 88..509
Protein Sequence: 513 a.a.     [Download]
>gi|260597721|ref|YP_003210292.1| unnamed protein product [Cronobacter turicensis z3032]
MLMSVQNTPSSAGETQVLETTGGVYASLFEKINLHPVAALGDIDTWQDSQSLADASADERVTAAVQVFLE
RLKQSGQKVEKLDKTLLDHHIADLDWQISRQLDAVMHHSEFQKVESLWRGLKHLVDRTDYRQNVRTEILD
ISKEDLRQDFEDAPEIVQSGLYWHTYTAEYDTPGGEPVGAVISSYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPTFFLKDTMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLTMPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTNASFAFAANMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVRLYAV
PHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2020072-2021613 Cronobacter turicensis z3032 chromosome, complete genome
ATGCTGATGTCTGTTCAGAATACCCCTTCTTCTGCCGGCGAAACGCAGGTGCTGGAAACCACTGGCGGCG
TGTACGCCTCGCTGTTTGAAAAAATCAACCTGCATCCGGTCGCCGCGCTTGGCGATATCGATACCTGGCA
GGACAGCCAGAGCCTGGCGGACGCCTCTGCCGATGAGCGCGTGACCGCCGCGGTACAGGTCTTTCTGGAG
CGCCTGAAACAGTCTGGCCAGAAAGTCGAAAAGCTCGATAAAACGCTGCTCGATCACCATATCGCCGATC
TGGACTGGCAAATCAGTCGCCAGCTGGATGCGGTGATGCACCACAGTGAATTTCAGAAAGTGGAATCGCT
GTGGCGCGGTCTGAAGCATCTGGTGGACCGTACCGATTACCGCCAGAACGTGCGCACCGAAATTCTGGAT
ATTTCCAAAGAAGATCTGCGTCAGGATTTCGAGGATGCCCCGGAAATTGTGCAGAGCGGCCTCTACTGGC
ACACCTACACGGCGGAATATGACACGCCCGGCGGCGAGCCGGTGGGGGCGGTGATTTCATCCTATGAATT
CGACGCCAGCGCGCAGGACATGGCCCTGCTGCGCAATATTTCCAAAGTTTCCGCCGCGGCGCACATGCCG
TTTATCGGCGCCGTCGGCCCGACATTCTTCCTGAAAGACACGATGGAAGAGGTGGCGGCCATCAAGGATA
TCGGCAACTACTTTGATCGCGCGGAATACATCAAATGGAAATCCTTCCGCGATACCGACGATGCCCGCTA
TATCGGCCTGACCATGCCGCGTGTGCTGGGCCGTCTGCCGTATGGCCCGGATACCGTGCCGGTGCGCAGC
TTTAACTACGTGGAAGAAGTGAAAGGCCCGGACCATGAGAAATACCTCTGGACCAACGCCTCGTTCGCCT
TCGCCGCCAATATGGTGCGCAGCTTTATTAATAACGGCTGGTGCGTGCAGATCCGCGGCCCGCAGGCGGG
CGGCGCGGTGCAGGACTTGCCGATCCATCTCTACGATCTTGGCACCGGCAATCAGGTGAAAATCCCGTCG
GAAGTGATGATCCCGGAGACCCGCGAATTTGAATTCGCCAACCTCGGCTTTATTCCGCTCTCGTATTACA
AAAACCGCGATTACGCCTGCTTCTTCTCGGCGAACTCCGCGCAGAAACCGGCGCTGTACGATACCCCGGA
CGCTACCGCTAACAGCCGCATCAACGCGCGCCTGCCGTATATCTTCCTGCTGTCGCGTATTGCGCATTAC
CTGAAGCTTATCCAGCGCGAAAACATCGGCACCACCAAAGATCGCCGCCTGCTGGAGCTTGAGCTGAATA
ACTGGGTGCGTGGGCTGGTCACGGAGATGACCGATCCGGGCGATGAGCTTCAGGCGTCACACCCGCTGCG
CGATGCAAAAGTGGTGGTGGAAGACATCGAAGACAATCCGGGCTTTTTCCGCGTCAGGCTCTATGCCGTG
CCGCATTTCCAGGTGGAAGGCATGGATGTCAACCTGTCGCTGGTGTCGCAGATGCCGAAAGCGAAAGCCT
GA