SecReT6
Protein ID: 260597722
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19300
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2021628..2022977 [+]
Producthypothetical protein
NoteTssK
UniProt IDC9Y2X9
KEGG IDctu:CTU_19300
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-125, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|260597722|ref|YP_003210293.1| unnamed protein product [Cronobacter turicensis z3032]
MKIYRPLWNEGALLSPQQFQQQSAWEAFTNAGVSALSSPFPWGVEKVELDDELLSSGRIQVRALRLWLPD
GTLVDTLNSDLAPPPRELNPSELAGQDTLTLLLALPLMQPGIVNVQKASAASERPLRYREEWVSLPDVFG
TEEESVAVAHFNLSLRFGHESNAFWQSCPVSRLVRDGQGGWRQDAAFIPPMALFSSNAMLQERLVLLNRQ
LRSRRQRLMSMRRESNERLADFAVADVSLFWLLNALNSHARVLSEYERFPARHPEQVWAELARLAGSMLT
FSLEHDLDTIPGYDHDEPEHTFPPLFDLITELLEASLPSRVIALPMSRIDELTWKTSLHDMRLREEADFY
LSVRSDIPAWEIAERFPGLCKAGSPDEVNSISINALNGIPLIPVTRVPAALPVRLENHYFALDMESAAAR
DMLEQGVCMFYVPSLLGALEIELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2021628-2022977 Cronobacter turicensis z3032 chromosome, complete genome
ATGAAGATATATCGACCATTATGGAACGAGGGGGCACTGCTGTCCCCTCAGCAGTTCCAGCAACAGTCTG
CCTGGGAAGCCTTCACGAACGCCGGGGTGTCGGCCCTGTCATCGCCTTTTCCCTGGGGTGTGGAGAAAGT
TGAACTGGATGACGAGCTGCTGTCATCCGGCCGCATTCAGGTGCGCGCGCTGCGTTTATGGCTACCCGAT
GGCACGCTGGTAGATACGCTGAATAGCGATCTTGCGCCGCCGCCGCGCGAACTTAACCCGAGTGAGCTGG
CGGGTCAGGACACCCTTACTTTGCTGCTGGCGTTGCCGCTGATGCAGCCAGGCATCGTTAATGTGCAGAA
GGCGTCCGCAGCCTCTGAGCGGCCGTTACGTTACCGCGAGGAGTGGGTTTCTCTGCCCGATGTGTTCGGG
ACAGAAGAGGAATCAGTGGCCGTGGCTCACTTTAATCTCTCTTTACGCTTTGGGCACGAAAGCAATGCAT
TCTGGCAGAGTTGTCCTGTCAGCCGACTTGTCCGTGACGGACAGGGCGGCTGGCGGCAAGATGCAGCTTT
TATTCCGCCGATGGCGCTGTTTTCCTCGAACGCGATGTTGCAGGAGCGCCTGGTCTTGCTTAACCGTCAG
TTGCGTTCCCGACGCCAGCGACTGATGTCTATGCGTCGCGAAAGTAACGAACGGCTGGCCGATTTTGCCG
TCGCGGATGTGTCGTTATTCTGGCTGCTCAATGCGCTTAACTCTCATGCGCGTGTGCTTAGCGAATATGA
GCGCTTTCCGGCTCGTCATCCTGAGCAAGTCTGGGCTGAACTGGCAAGGCTGGCAGGCAGTATGCTGACG
TTTTCCCTGGAACACGACCTGGACACTATTCCTGGTTATGACCATGACGAGCCGGAGCACACTTTCCCCC
CGCTGTTCGATCTGATAACCGAATTGCTGGAAGCAAGCCTGCCTTCACGGGTTATCGCGCTGCCCATGTC
CCGCATTGACGAACTGACATGGAAAACCTCGCTGCATGATATGCGGCTGCGTGAAGAAGCGGATTTCTAT
CTTTCGGTACGCTCCGATATTCCCGCCTGGGAGATTGCTGAGCGTTTCCCTGGCCTGTGTAAAGCCGGCT
CCCCGGATGAGGTGAACTCCATTTCTATCAATGCGCTAAACGGGATACCGCTTATTCCTGTCACGCGCGT
GCCTGCCGCGCTGCCGGTGCGTCTGGAAAATCACTATTTTGCGCTGGATATGGAAAGCGCGGCGGCGCGC
GACATGCTGGAGCAGGGCGTCTGTATGTTCTATGTGCCCTCGCTGCTGGGGGCGCTGGAGATTGAACTGT
TTGCGGTACTGCGCTCATGA