SecReT6
Protein ID: 260597723
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19310
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2022974..2023660 [+]
Producthypothetical protein
NoteTssL
UniProt IDC9Y2Y0
KEGG IDctu:CTU_19310
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-40, Aligned region: 7..215
Protein Sequence: 228 a.a.     [Download]
>gi|260597723|ref|YP_003210294.1| unnamed protein product [Cronobacter turicensis z3032]
MREEIDIDKLMADTWLTVTLLRYGSSVPDGKSLYQRCCDQVESVRDALQKAGYDDTSIDHISYAQCALLD
ETVMSRKPALGEGGEDPVTDEGQKEWRTAPLQARYFGSLRAGEAIWDRIAEVLRQPAPSQAVLTCYHRVL
SLGFQGLYGVKTVSTTQREETLKALSARVSPINTDISLVVRRTKKRRYSLLRSVGFWILFSVVVTGAVWW
CGHLWLQALLSAQLPEQH
 
Nucleotide Sequence: 687 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2022974-2023660 Cronobacter turicensis z3032 chromosome, complete genome
ATGAGAGAAGAAATCGACATAGATAAATTGATGGCCGATACCTGGCTTACGGTCACGCTGTTGCGATATG
GCTCTTCGGTTCCTGACGGCAAATCGCTGTATCAACGCTGCTGCGATCAGGTAGAAAGCGTCCGCGACGC
GCTTCAAAAGGCGGGTTATGACGACACCAGCATAGACCATATCTCTTATGCCCAGTGCGCGCTGCTTGAT
GAAACCGTCATGAGCCGTAAACCAGCGTTGGGAGAGGGCGGTGAAGATCCTGTTACGGATGAAGGGCAGA
AAGAATGGCGTACGGCGCCGCTGCAGGCCCGTTACTTTGGTTCCTTACGCGCCGGGGAAGCTATCTGGGA
TCGCATCGCGGAAGTGTTACGCCAGCCTGCTCCATCACAGGCGGTACTGACCTGCTATCACCGCGTCCTC
TCGCTCGGTTTCCAGGGACTGTATGGTGTGAAAACGGTCAGTACCACTCAGCGTGAGGAGACGCTGAAAG
CGCTTAGCGCACGGGTTTCACCGATCAATACGGATATTTCACTGGTGGTCCGCAGAACTAAGAAACGTCG
CTATAGTCTGTTGCGATCCGTTGGATTCTGGATCCTGTTTTCGGTCGTCGTCACGGGCGCTGTCTGGTGG
TGCGGACACCTCTGGCTCCAGGCGCTGCTGTCTGCTCAACTTCCGGAGCAGCATTGA