SecReT6
Protein ID: 260597726
SecReT6 ID364
T6SS typei2
Gene symbolclpV1
Locus tagCTU_19340
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2026089..2028779 [+]
Productprotein clpV1
NoteTssH
UniProt IDC9Y2Y3
KEGG IDctu:CTU_19340
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-40, Aligned region: 246..265
AAA_2 [PF07724], Evalue: 2.30E-40, Aligned region: 620..785
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 248..380
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 593..608
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 625..749
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 773..790
AAA_5 [PF07728], Evalue: 2.50E-14, Aligned region: 92..117
AAA_5 [PF07728], Evalue: 2.50E-14, Aligned region: 248..268
AAA_5 [PF07728], Evalue: 2.50E-14, Aligned region: 322..378
AAA_5 [PF07728], Evalue: 2.50E-14, Aligned region: 624..742
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 149..167
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 225..269
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 293..327
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 595..661
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 688..718
AAA_16 [PF13191], Evalue: 3.60E-13, Aligned region: 763..873
ClpB_D2-small [PF10431], Evalue: 1.30E-12, Aligned region: 791..867
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 71..104
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 247..333
AAA_22 [PF13401], Evalue: 3.30E-10, Aligned region: 621..664
AAA_19 [PF13245], Evalue: 5.00E-09, Aligned region: 245..270
AAA_19 [PF13245], Evalue: 5.00E-09, Aligned region: 620..647
AAA_25 [PF13481], Evalue: 2.90E-08, Aligned region: 248..321
AAA_25 [PF13481], Evalue: 2.90E-08, Aligned region: 371..407
AAA_25 [PF13481], Evalue: 2.90E-08, Aligned region: 620..653
IstB_IS21 [PF01695], Evalue: 9.40E-07, Aligned region: 242..309
IstB_IS21 [PF01695], Evalue: 9.40E-07, Aligned region: 624..644
AAA_17 [PF13207], Evalue: 2.70E-06, Aligned region: 248..311
AAA_17 [PF13207], Evalue: 2.70E-06, Aligned region: 623..660
Arch_ATPase [PF01637], Evalue: 5.10E-06, Aligned region: 226..263
Arch_ATPase [PF01637], Evalue: 5.10E-06, Aligned region: 300..397
Arch_ATPase [PF01637], Evalue: 5.10E-06, Aligned region: 617..639
Arch_ATPase [PF01637], Evalue: 5.10E-06, Aligned region: 694..706
Zeta_toxin [PF06414], Evalue: 6.30E-06, Aligned region: 242..272
Zeta_toxin [PF06414], Evalue: 6.30E-06, Aligned region: 611..664
NACHT [PF05729], Evalue: 9.10E-06, Aligned region: 248..276
NACHT [PF05729], Evalue: 9.10E-06, Aligned region: 472..521
NACHT [PF05729], Evalue: 9.10E-06, Aligned region: 624..648
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 248..349
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 622..706
Sigma54_activat [PF00158], Evalue: 4.20E-05, Aligned region: 231..262
Sigma54_activat [PF00158], Evalue: 4.20E-05, Aligned region: 624..741
AAA_18 [PF13238], Evalue: 7.70E-05, Aligned region: 248..274
AAA_18 [PF13238], Evalue: 7.70E-05, Aligned region: 625..654
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 242..264
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 620..647
RNA_helicase [PF00910], Evalue: 0.00042, Aligned region: 249..270
RNA_helicase [PF00910], Evalue: 0.00042, Aligned region: 492..514
RNA_helicase [PF00910], Evalue: 0.00042, Aligned region: 625..646
RNA_helicase [PF00910], Evalue: 0.00042, Aligned region: 722..743
AAA_28 [PF13521], Evalue: 0.0018, Aligned region: 248..267
AAA_28 [PF13521], Evalue: 0.0018, Aligned region: 624..644
Clp_N [PF02861], Evalue: 0.0025, Aligned region: 32..66
Clp_N [PF02861], Evalue: 0.0025, Aligned region: 115..132
T2SE [PF00437], Evalue: 0.0025, Aligned region: 230..267
T2SE [PF00437], Evalue: 0.0025, Aligned region: 621..702
DUF2075 [PF09848], Evalue: 0.0026, Aligned region: 250..350
DUF2075 [PF09848], Evalue: 0.0026, Aligned region: 403..418
DUF2075 [PF09848], Evalue: 0.0026, Aligned region: 623..646
TIP49 [PF06068], Evalue: 0.0049, Aligned region: 248..269
TIP49 [PF06068], Evalue: 0.0049, Aligned region: 313..328
TIP49 [PF06068], Evalue: 0.0049, Aligned region: 592..645
AAA_30 [PF13604], Evalue: 0.0049, Aligned region: 244..269
AAA_30 [PF13604], Evalue: 0.0049, Aligned region: 621..650
AAA_33 [PF13671], Evalue: 0.0072, Aligned region: 248..265
AAA_33 [PF13671], Evalue: 0.0072, Aligned region: 433..463
AAA_33 [PF13671], Evalue: 0.0072, Aligned region: 623..645
ResIII [PF04851], Evalue: 0.0079, Aligned region: 233..270
ResIII [PF04851], Evalue: 0.0079, Aligned region: 318..331
ResIII [PF04851], Evalue: 0.0079, Aligned region: 596..647
AAA_23 [PF13476], Evalue: 0.0081, Aligned region: 248..265
AAA_23 [PF13476], Evalue: 0.0081, Aligned region: 621..648
Protein Sequence: 896 a.a.     [Download]
>gi|260597726|ref|YP_003210297.1| clpV1 gene product [Cronobacter turicensis z3032]
MSAIRGKMNMEHQSAVLLRRLNPYCARALEAAATLCQTRAHASIAPEHWLLKLLELGEGDITVIARRYEW
DMDGLWQNLLAHLDRLPRSVRGRPELADHLQSLLQQAWLYASLEDNSQIRGVHLLMAITEKPSLIQCDGI
WPLQSLSRAQLERLRPMLDAQSDERPEAQQEAQLTRDSGDGVAFAGHAEKEPVKEGGLNPALQAVLDKFT
LDITAKAKAGDIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDNLKPV
SVRTLDLGLLQAGAGVKGEFEQRLKTIIDAVRHSSAPVLLFIDEAHTLIGAGNQAGGADAANLLKPALAR
GELRTIAATTWSEYKQYFERDAALERRFQRVKVDEPDDDTACLMLRGLKPRYAQHHGVYITDEAVRAAVT
LSRRYLTGRQLPDKAVDLLDTASARVRMSLDTVPEPLTQRRARITALELEKQALLEEIALGSTAHGERLA
AIEQEEVCIILDLDSLETQYDQELAATERLLACRRDISRQAERAAVQEELAIAQQGNPLLGLDVDARTVA
TVIADWTGVPLSSLMKDEQTELLSLEQKLGARVVGQTAALEAVAQRLRASKTGLTPENGPQGVFLLTGPS
GTGKTETALALADALFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLD
EVEKAHRDVMNLFYQVFDRGFMRDGEGCEIDFRNTVILMTSNLGSDHIMQLLEEKPDATDTDLHELLRPI
LRDHFQPALLARFQTVIYRPLHPQAMRAIVEMKLSQVSLRLHRHYGLTTEIRESLYDALTAACLLPDTGA
RNIDSLLAQQILPVLSQQLLSHMAAKQKPLSLTLGWSEEEGVVMEFDVAIKERGNE
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2026089-2028779 Cronobacter turicensis z3032 chromosome, complete genome
GTGTCTGCAATCAGAGGGAAGATGAATATGGAACACCAGTCAGCCGTATTACTGCGCCGTTTAAATCCTT
ACTGCGCCCGCGCGCTGGAAGCGGCGGCCACGCTGTGTCAGACCCGCGCTCACGCCTCTATTGCGCCTGA
GCACTGGTTGCTCAAGCTGCTGGAACTGGGCGAAGGGGATATCACGGTGATCGCCCGTCGCTACGAATGG
GATATGGATGGGCTGTGGCAGAATTTACTCGCGCATCTGGACAGGCTGCCTCGCTCGGTGCGCGGACGCC
CGGAGCTTGCTGATCATCTGCAAAGCCTGCTGCAACAGGCCTGGCTGTATGCCTCGCTGGAAGATAACAG
CCAGATACGCGGCGTACATCTGCTGATGGCGATAACCGAAAAACCGTCGCTGATTCAATGCGACGGCATA
TGGCCGCTACAGAGCCTTTCACGCGCGCAACTTGAGCGTCTGCGCCCGATGCTGGATGCGCAGTCGGATG
AACGTCCCGAGGCGCAGCAGGAAGCGCAACTCACCCGCGACTCTGGCGACGGCGTGGCGTTTGCCGGTCA
TGCGGAAAAAGAGCCGGTAAAAGAGGGCGGACTCAACCCGGCGCTTCAGGCTGTGCTGGATAAGTTCACT
CTTGATATCACGGCGAAAGCGAAAGCCGGAGACATCGACCCGGTCTTTGGCCGTGACAACGAAATCCGCC
AGATGGTGGATATTCTCTCACGGCGTCGCAAGAACAACCCGATACTGGTCGGCGAGCCGGGGGTCGGCAA
AACCGCGCTGGTGGAAGGTCTGGCGCTCAGAATCGCGGAGGGCAACGTGCCGGATAACCTGAAACCGGTA
TCGGTACGCACGCTTGACCTCGGCCTGTTACAGGCGGGCGCGGGTGTGAAAGGCGAATTTGAGCAGCGGC
TGAAAACCATCATTGACGCGGTGCGTCACTCCTCTGCGCCGGTACTGCTGTTTATCGACGAGGCGCATAC
CCTCATTGGCGCGGGCAACCAGGCGGGCGGCGCAGACGCGGCCAACCTGCTGAAACCGGCGCTGGCGCGC
GGCGAACTCAGAACCATCGCGGCCACCACCTGGAGCGAGTACAAGCAATACTTTGAGCGTGACGCCGCGC
TGGAGCGCCGCTTCCAGAGGGTGAAAGTCGATGAGCCGGACGACGACACCGCCTGCCTGATGCTCCGCGG
CCTGAAACCCCGCTACGCGCAGCACCATGGCGTGTACATTACCGATGAGGCTGTCCGGGCCGCCGTCACG
CTCTCACGGCGTTATCTCACCGGGCGCCAGCTACCGGACAAAGCGGTGGACCTGCTGGATACGGCGTCAG
CCCGTGTGCGCATGAGTCTCGATACCGTACCGGAGCCGCTGACGCAGCGGCGCGCCCGCATTACCGCCCT
CGAACTCGAAAAGCAGGCGCTGCTGGAAGAGATCGCGCTGGGCAGTACCGCGCATGGCGAGCGACTGGCG
GCGATTGAACAGGAAGAAGTCTGCATTATTCTTGATCTTGATTCGCTGGAAACGCAGTACGATCAGGAGC
TCGCCGCAACGGAGCGGTTGCTGGCCTGCCGGCGCGATATTTCCCGCCAGGCGGAGCGTGCGGCAGTGCA
AGAAGAACTGGCGATCGCTCAGCAGGGCAACCCGCTGCTGGGGCTGGATGTGGATGCGCGTACCGTGGCG
ACGGTGATTGCCGACTGGACCGGCGTGCCGCTCTCATCCCTGATGAAGGATGAACAGACAGAGCTGCTGA
GCCTTGAGCAGAAGCTGGGCGCGCGCGTGGTTGGTCAGACGGCGGCTCTGGAGGCGGTCGCGCAGCGGCT
GCGCGCGTCGAAAACCGGGCTCACGCCAGAAAATGGCCCACAGGGTGTGTTCCTGCTCACCGGCCCGAGC
GGCACAGGCAAAACCGAAACGGCGCTGGCGCTGGCGGATGCGCTGTTCGGCGGCGAAAAATCGCTGATAA
CCATCAACCTTTCAGAATATCAGGAGCCGCACACCGTTTCGCAGCTTAAGGGGTCGCCGCCGGGCTATGT
CGGTTACGGCCAGGGCGGCATTCTCACCGAAGCGGTGCGCAAACGTCCCTACAGCGTGGTGCTGCTCGAT
GAAGTGGAAAAGGCGCACCGCGACGTCATGAACCTCTTCTATCAGGTGTTTGACCGCGGCTTTATGCGCG
ACGGCGAAGGATGCGAAATCGATTTTCGCAATACGGTTATTTTGATGACTTCCAACCTTGGCAGCGACCA
CATCATGCAGTTGCTGGAAGAAAAGCCGGATGCCACCGATACCGACCTGCATGAACTGCTGCGCCCGATA
TTGCGCGACCATTTCCAGCCTGCCTTACTCGCTCGCTTCCAGACGGTGATTTACCGCCCGCTGCACCCAC
AGGCGATGCGTGCCATCGTGGAAATGAAGCTGTCGCAGGTAAGCCTGCGCCTGCATCGTCATTACGGCCT
GACGACAGAAATCAGAGAAAGCCTGTACGACGCCCTGACGGCGGCTTGCCTGCTGCCGGACACCGGCGCG
CGCAATATCGACAGCCTGCTGGCGCAGCAGATCCTGCCGGTGCTGAGTCAGCAGCTATTAAGCCACATGG
CGGCGAAGCAGAAGCCGCTCTCTCTGACGCTGGGGTGGAGTGAGGAAGAGGGTGTGGTGATGGAGTTTGA
TGTGGCGATAAAGGAGCGCGGAAATGAGTGA