SecReT6
Protein ID: 260597727
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19350
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2028772..2031129 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y2Y4
KEGG IDctu:CTU_19350
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-62, Aligned region: 41..354
Phage_GPD [PF05954], Evalue: 3.20E-62, Aligned region: 526..526
DUF2345 [PF10106], Evalue: 1.30E-38, Aligned region: 609..755
T6SS_Vgr [PF13296], Evalue: 4.20E-35, Aligned region: 486..591
T6SS_Vgr [PF13296], Evalue: 4.20E-35, Aligned region: 636..649
Phage_base_V [PF04717], Evalue: 1.00E-15, Aligned region: 12..41
Phage_base_V [PF04717], Evalue: 1.00E-15, Aligned region: 400..481
Protein Sequence: 785 a.a.     [Download]
>gi|260597727|ref|YP_003210298.1| unnamed protein product [Cronobacter turicensis z3032]
MSDVTLDTTVAQAAQLLGQSRYRVDIHGCSDFLDVLSFSAEEALSAPWYYDIALTCANPDIACDTLLLKP
GSFTFQTPLFTGAPATEVRSVYGVVQSFRRVSTSADETRYTLRLVPRIALMQHTRRSEIYLNQSVVEVVE
KVLREHELEGADFEFRLSREYPQRELITQWRETDLAFIQRLLAEVGIFWRFEMDSRLGQDVVIFQDSQAQ
YQFGVTMPLRHPSGMSDSGQESVWDLQTAFDVVSGSVATRDYNYREALTPQDSTQSVSSTDGITTGEVYH
YAEPFLTEGDSDSPETGAYYARLRHERLLNGQSLITGRSTSPHLLPGQVLEADGSLPETLKAGIVITRIR
SRGSRRASFLLDFDGIPYSETVCFRPPLRRRPVISGTLPARVESTQKGDIYAWLDETGRYRVKLDVDRTG
REPGYAYLWLRLAKPYAGDNYGWHAPLLDGTEVSVAFDSGDPDRPYIAHAQHDSAHPDHVTRDNHTRNVL
RTPANNKLRLEDQRQQEHIKLATEYGKTQLNMGHLVDARRQARGTGFELRTDEYGAVRAAKGIYLSAHEQ
MKAQGPVLEMTQALGQIHQANREMQALNNAAKVAQALTCDIGTQLSLVQDRLAQLHSAVVLASAPRGMAL
SSGEHLQLTSAGNTMINAGQHLDVGAMKNLSVTVEKALGLFVHKDGAKVVANQGEVEIQAQHNTMSLFAR
DRFTVTSNEDEIVISTPETLTLNGGGSYLKLSKSGIEHGSQGDMLMKVATYLVTGTGATLPHEAPEFSMK
DITQENTMSSKAFND
 
Nucleotide Sequence: 2358 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2028772-2031129 Cronobacter turicensis z3032 chromosome, complete genome
ATGAGTGATGTTACGCTGGATACAACCGTCGCTCAGGCGGCGCAGCTTCTGGGCCAGTCCCGATATCGGG
TCGATATTCATGGCTGCAGTGACTTTCTGGACGTGCTGAGTTTCAGCGCGGAAGAAGCGCTTAGCGCACC
CTGGTATTACGACATCGCGCTCACCTGTGCGAACCCCGATATCGCCTGCGACACGCTGCTGCTCAAACCC
GGTTCCTTTACTTTCCAGACGCCGCTGTTTACCGGCGCGCCCGCAACAGAAGTGCGCAGCGTTTATGGCG
TGGTGCAGTCGTTCCGGCGTGTTTCAACCTCGGCAGACGAAACGCGGTACACCCTGCGCCTGGTGCCGCG
TATCGCCCTGATGCAGCATACCCGACGCAGTGAAATTTACCTTAATCAGTCGGTGGTTGAGGTGGTGGAG
AAAGTACTGCGTGAGCATGAGCTGGAAGGCGCTGATTTCGAGTTTCGCCTGTCGCGTGAATACCCGCAGC
GTGAACTGATCACGCAGTGGCGCGAAACCGATCTGGCGTTCATCCAGCGCCTGCTGGCAGAAGTGGGTAT
TTTCTGGCGTTTCGAGATGGACAGCCGGCTTGGTCAGGATGTCGTGATCTTTCAGGACTCCCAGGCGCAG
TACCAGTTTGGCGTGACGATGCCGTTGCGACATCCGTCGGGCATGAGCGACAGCGGACAGGAAAGCGTCT
GGGATCTCCAGACCGCGTTTGATGTGGTGAGCGGCAGCGTCGCCACTCGCGACTATAACTACCGCGAGGC
GCTGACGCCGCAGGACAGCACGCAGTCCGTCAGCAGCACAGACGGCATTACCACCGGTGAGGTATATCAC
TATGCCGAACCGTTTCTGACCGAAGGCGACAGCGACAGCCCGGAGACCGGCGCGTATTACGCCAGGCTTC
GTCATGAGCGACTTCTCAACGGGCAGTCGCTGATAACCGGTCGCAGCACCAGCCCGCATCTGTTACCCGG
CCAGGTGCTCGAGGCGGATGGCAGCCTGCCGGAGACGCTGAAAGCGGGCATCGTCATTACCCGTATCCGC
AGCCGCGGTTCGCGCCGGGCCAGTTTCCTACTGGATTTTGACGGCATTCCCTACAGCGAAACAGTCTGCT
TTCGCCCGCCGCTGCGCAGGCGACCGGTGATATCCGGCACGCTGCCTGCCCGGGTGGAGAGCACGCAGAA
GGGTGACATTTACGCCTGGCTGGACGAGACCGGGCGCTACCGGGTGAAGCTGGATGTTGACCGCACCGGC
CGCGAGCCGGGTTATGCGTACCTCTGGTTGCGGCTGGCGAAACCCTATGCGGGCGATAATTACGGCTGGC
ACGCCCCGCTGCTGGACGGCACGGAGGTGTCGGTGGCCTTTGACAGTGGCGACCCGGACCGTCCATATAT
CGCCCACGCGCAGCATGACTCCGCACACCCGGACCACGTCACCCGCGACAACCACACCCGCAACGTGCTG
CGCACGCCCGCGAACAACAAATTACGGCTGGAAGACCAGCGGCAGCAGGAGCACATCAAGCTCGCCACGG
AGTACGGCAAGACGCAGCTGAACATGGGGCACCTGGTGGATGCCCGGCGACAGGCGCGCGGCACCGGTTT
TGAGCTGCGCACGGATGAGTACGGCGCGGTGCGGGCGGCGAAGGGGATATACCTGTCGGCGCATGAACAG
ATGAAAGCGCAGGGACCGGTGCTGGAAATGACGCAGGCGCTGGGCCAGATACATCAGGCGAACCGTGAGA
TGCAGGCGCTGAATAACGCGGCGAAGGTGGCGCAGGCGCTGACCTGCGATATCGGCACGCAGCTGTCTCT
GGTGCAGGACCGGCTGGCGCAGCTGCATTCCGCCGTGGTGCTGGCAAGCGCGCCACGGGGGATGGCGCTC
AGCTCCGGGGAACATCTCCAGCTGACCAGCGCCGGAAACACCATGATAAACGCCGGTCAGCATCTGGATG
TGGGGGCGATGAAAAACCTGTCGGTGACGGTGGAGAAAGCGCTGGGGCTGTTTGTGCATAAGGACGGCGC
GAAGGTGGTGGCGAATCAGGGTGAGGTGGAGATACAGGCGCAGCACAACACGATGTCGCTGTTCGCGCGT
GACCGTTTCACCGTCACGAGTAATGAGGATGAGATTGTCATCAGCACGCCGGAGACGCTGACGCTGAACG
GCGGCGGGTCGTATCTGAAGCTGAGCAAAAGCGGCATTGAGCACGGCTCACAGGGTGACATGCTGATGAA
GGTGGCGACGTATCTGGTAACGGGGACGGGGGCAACGCTTCCCCATGAAGCGCCTGAATTCAGCATGAAA
GATATTACTCAGGAAAACACCATGAGCAGCAAAGCTTTTAACGACTGA