SecReT6
Protein ID: 260597730
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19380
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2034395..2035507 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y2Y7
KEGG IDctu:CTU_19380
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 2.80E-39, Aligned region: 194..340
T6SS_Vgr [PF13296], Evalue: 6.10E-36, Aligned region: 71..176
T6SS_Vgr [PF13296], Evalue: 6.10E-36, Aligned region: 217..226
Phage_base_V [PF04717], Evalue: 9.40E-12, Aligned region: 14..66
Protein Sequence: 370 a.a.     [Download]
>gi|260597730|ref|YP_003210301.1| unnamed protein product [Cronobacter turicensis z3032]
MGQRFAKSRICNFWLRLAKPYAGDNYGWHAPLLDGTEVSVAFDSGDPDRPYIAHAQHDSAHPDHVTRDNH
TRNVLRTPANNKLRLEDQRQQEHIKLATEYGKTQLNLGHLVDARRQARGTGFELRTDEYGAVRAAKGIYL
SAHEQLKAQGPVLAMTEALGQINQANREMQALNNAAKVAQALTCDIGTQLSLVQDRLAQLHSAVVLASAP
RGMALSSGEHLQLTSAGNTMINAGQHLDVGAMKNLSVTVEKALGLFVHKDGAKVVANQGEVEIQAQHNTM
SLFARDRFTVTSNEDEIVISTPETLTLNGGGSYLKLSKSGIEHGSQGDMLMKVATYLVTGTGADMPNETV
NFRKGDISVQDDFSSKSRND
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2034395-2035507 Cronobacter turicensis z3032 chromosome, complete genome
ATGGGCCAGAGATTTGCAAAGAGCCGGATATGCAACTTCTGGCTGCGGCTGGCAAAACCCTACGCGGGGG
ATAATTACGGCTGGCACGCCCCGCTGCTGGACGGCACGGAGGTGTCGGTGGCCTTTGACAGTGGCGACCC
GGACCGTCCATATATCGCCCACGCGCAGCATGACTCCGCACACCCGGACCACGTCACCCGCGACAACCAC
ACCCGCAACGTGCTGCGCACGCCCGCTAACAACAAATTACGGCTGGAAGACCAGCGGCAGCAGGAGCACA
TCAAGCTCGCCACGGAGTACGGCAAGACACAGCTGAACCTGGGGCATCTGGTGGATGCCCGGCGACAGGC
GCGCGGCACCGGTTTTGAGCTGCGCACGGATGAGTACGGCGCGGTGCGGGCGGCAAAGGGGATATACCTG
TCGGCGCATGAGCAGCTGAAAGCGCAGGGACCGGTGCTGGCGATGACAGAGGCGCTGGGCCAGATAAATC
AGGCGAACCGTGAGATGCAGGCGCTGAATAACGCGGCGAAGGTGGCGCAGGCGCTGACCTGCGATATCGG
CACGCAGCTGTCTCTGGTGCAGGACCGGCTGGCGCAGCTGCATTCCGCCGTGGTGCTGGCAAGCGCGCCA
CGGGGGATGGCGCTCAGCTCCGGGGAACATCTCCAGCTGACCAGCGCCGGAAACACCATGATAAACGCCG
GTCAGCATCTGGATGTGGGGGCGATGAAAAACCTGTCGGTGACGGTGGAGAAAGCGCTGGGGCTGTTTGT
GCATAAGGACGGCGCGAAGGTGGTGGCGAATCAGGGTGAGGTGGAGATACAGGCGCAGCACAACACGATG
TCGCTGTTCGCGCGTGACCGTTTCACCGTCACGAGTAATGAGGATGAGATTGTCATCAGCACGCCGGAGA
CGCTGACGCTGAACGGCGGCGGGTCGTATCTGAAGCTGAGCAAAAGCGGCATTGAGCACGGCTCGCAGGG
TGACATGCTGATGAAGGTGGCGACCTATCTGGTGACGGGGACGGGGGCTGACATGCCAAATGAAACCGTG
AATTTCAGAAAAGGCGATATTTCGGTACAGGATGATTTCAGCAGTAAATCGAGGAATGACTAG