SecReT6
Protein ID: 260597742
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19500
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2048349..2048687 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y3H8
KEGG IDctu:CTU_19500
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 6.60E-12, Aligned region: 11..63
T6SS_Vgr [PF13296], Evalue: 2.20E-10, Aligned region: 68..108
Protein Sequence: 112 a.a.     [Download]
>gi|260597742|ref|YP_003210313.1| unnamed protein product [Cronobacter turicensis z3032]
MGREPGYAYLWLRLAKPYAGDNYGWHAPLLDGTEVSVAFDSGDPDRPYIAHAQLDSAHPDHVTRDNHTRN
VLRTPANNKLRLEDQRQQEHIKLATEYGKIQLNLGHLMWVKS
 
Nucleotide Sequence: 339 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2048349-2048687 Cronobacter turicensis z3032 chromosome, complete genome
TTGGGCCGCGAGCCGGGTTATGCGTACCTCTGGTTGCGGCTGGCGAAACCCTATGCGGGCGATAATTACG
GCTGGCACGCCCCGCTGCTGGACGGCACGGAGGTGTCGGTGGCCTTTGACAGCGGCGACCCGGACCGTCC
GTACATCGCCCACGCGCAGCTTGACTCCGCACACCCGGACCACGTTACCCGCGACAACCACACCCGCAAC
GTGCTGCGCACGCCCGCGAACAACAAATTACGGCTGGAAGACCAGCGGCAGCAGGAGCACATCAAGCTCG
CCACGGAGTATGGCAAGATCCAGCTCAATCTCGGGCACCTGATGTGGGTGAAAAGTTAA