SecReT6
Protein ID: 260597746
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19540
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2053943..2055733 [+]
Producthypothetical protein
NoteTssF
UniProt IDC9Y3I2
KEGG IDctu:CTU_19540
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-186, Aligned region: 13..593
XS [PF03468], Evalue: 0.0021, Aligned region: 68..120
Protein Sequence: 596 a.a.     [Download]
>gi|260597746|ref|YP_003210317.1| unnamed protein product [Cronobacter turicensis z3032]
MTFRNLCMDDLTLRYYEAEMRYLREAGKEFSRTHPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREK
LDDDLPELTEGLVSLLWPHYMRTIPSLSIVEFSPDWRGLRQAESLPESFSVLSRPVGPHKTACQYRTTRE
VTLQPLSLTEARLHTESDGRSAIRLRFTCSQKVDWAKAGIDNVAIFLNAESPVSSALHLALTRQVHAIYA
RHSGTHAERLRFDGWFRPMGFDDTDRLWPKGDSAFSGYQLLLEYFSFRSKFLFVELRGLDTIGLTAESDW
FEIDIVLTEAWSADLPFETENFRLHCAPVINLFTLEADPLTLNPLENEYLLRPLRLQDGHTEIYSVDNLH
GAVKNGKHAYVPFTSFRHRGGMMRFDAPERYFHTRVKRGPSGLHDTWLILGGRSFEMEQLAEKPESLSMR
ITGTNGQLPRKALQSTLIDRVVKIGKVPVSVLNLTAPTQPLYPPASDRFHWRVMSHLGSNFLSMMDNPEV
LRGTLALYDWTDDEMNRRRLDAIVAVKHTLIRRFEQGFMQRGVDIEVTLDTQHFAGEGDVNLFGEMLHRF
FALYADIHLFNQLTLVLQPTGKRLRWRENHSQRIPG
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2053943-2055733 Cronobacter turicensis z3032 chromosome, complete genome
ATGACATTCAGGAATTTGTGCATGGATGATTTAACCTTGCGCTACTACGAGGCTGAAATGCGCTATTTGC
GCGAAGCCGGAAAGGAATTTTCCCGCACCCACCCTGACCGGGCGGCGATGCTGAATCTTGATAAACCCGG
CGCCCGGGATCCGTACGTCGAGCGCCTTTTTGAAGGGTTTGCGTTTTTAATGGGGCGGCTTCGCGAGAAG
CTTGACGACGATCTTCCCGAACTTACAGAAGGGCTGGTAAGCCTGCTCTGGCCGCACTACATGCGCACCA
TTCCTTCACTGTCGATTGTTGAGTTTTCGCCCGACTGGCGCGGGCTTCGGCAGGCCGAATCGCTGCCGGA
GAGCTTTTCCGTATTATCCCGCCCGGTCGGACCGCACAAAACGGCCTGCCAGTATCGCACCACTCGCGAA
GTAACGTTGCAACCGCTGAGTCTGACTGAGGCGCGTCTGCATACTGAATCTGACGGGCGCTCCGCCATTC
GTCTGCGCTTTACGTGCAGCCAGAAAGTTGACTGGGCCAAAGCCGGAATAGATAACGTGGCGATTTTCCT
CAATGCGGAAAGCCCGGTGAGCTCGGCGCTGCACCTGGCGTTGACCCGCCAGGTGCATGCCATCTATGCG
CGCCATAGCGGAACCCACGCCGAGCGCCTGCGTTTTGATGGCTGGTTTCGCCCGATGGGTTTCGACGATA
CAGACCGGCTATGGCCGAAAGGGGATTCTGCGTTCAGCGGTTATCAGTTGCTGCTGGAGTATTTCAGCTT
CAGGTCGAAATTTCTGTTTGTTGAATTGCGCGGTCTTGACACCATCGGTCTGACGGCTGAAAGCGACTGG
TTTGAAATTGATATCGTACTCACCGAGGCATGGTCTGCCGACCTGCCGTTCGAAACCGAAAACTTCCGTC
TGCACTGCGCGCCTGTGATCAACCTCTTTACGCTGGAGGCCGATCCTCTGACGCTCAATCCCCTGGAAAA
TGAGTACCTGCTGCGGCCATTACGCCTTCAGGATGGTCACACTGAAATCTACAGTGTCGATAACCTTCAC
GGTGCCGTGAAAAACGGCAAACACGCTTATGTCCCCTTTACCAGTTTTCGACACCGTGGCGGCATGATGC
GGTTCGATGCGCCTGAGCGCTATTTTCATACCCGCGTGAAGCGAGGCCCTTCCGGCTTGCACGATACGTG
GCTGATTCTCGGTGGTCGCTCATTTGAAATGGAACAACTGGCCGAAAAACCAGAATCGCTGTCGATGCGT
ATCACCGGCACCAATGGTCAACTGCCCCGTAAAGCGCTGCAAAGCACCCTGATTGACAGGGTAGTGAAAA
TCGGCAAAGTGCCGGTCAGCGTGCTCAACCTTACCGCGCCCACCCAGCCGCTTTATCCTCCGGCCAGCGA
TCGTTTTCACTGGCGCGTAATGAGCCATCTGGGCTCGAATTTTCTTAGCATGATGGATAACCCGGAAGTG
CTGCGCGGCACGCTGGCGCTATACGACTGGACCGATGATGAGATGAACCGTCGTCGTCTGGACGCGATCG
TCGCGGTTAAACACACCCTTATACGCCGCTTTGAACAGGGTTTTATGCAAAGAGGCGTGGATATAGAGGT
GACGCTGGACACTCAGCATTTTGCGGGTGAAGGCGATGTCAATCTCTTTGGTGAAATGCTGCATCGCTTC
TTTGCGCTTTACGCGGATATTCATCTTTTTAACCAGCTCACGCTGGTGTTGCAACCGACAGGGAAACGAC
TGAGATGGCGCGAGAACCACAGTCAGCGCATACCGGGCTGA