SecReT6
Protein ID: 260597747
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19550
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2055697..2056779 [+]
Producthypothetical protein
NoteTssG
UniProt IDC9Y3I3
KEGG IDctu:CTU_19550
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-78, Aligned region: 19..321
Protein Sequence: 360 a.a.     [Download]
>gi|260597747|ref|YP_003210318.1| unnamed protein product [Cronobacter turicensis z3032]
MAREPQSAHTGLTEQLGDDIWRVNFYRFCQLLEQEHPARPLLGSTSHPGNDPVRFRPWPGMGFPASELRK
GEIDAEHPDVPPTVRTTFLGMYGVDSPLAGGYLDDVAQRREGYEAVSSFLDIFSHRVVTQYYRIWRKYAY
PATFEPGATDATSQCLLGLVGLGIPGTAQHVATPVSRFLALLGAMRLPTRNAEGIRALVSLLAPDTHADI
NDHDPVQVRVTNRCGLGAGRRVHLRQRATLGKTAREANSRVLITLSTHHAQEATDWLPGGQLYMDLLALM
RVYLGYRSDARLRLTVPVHLLPDPALTKHRRIQLGRTGLLGLKNGKLSDNRQLITVSLGCYESLNCAALP
LAMKGNYRFD
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2055697-2056779 Cronobacter turicensis z3032 chromosome, complete genome
ATGGCGCGAGAACCACAGTCAGCGCATACCGGGCTGACAGAGCAATTAGGCGATGATATCTGGCGTGTTA
ATTTCTACCGTTTCTGCCAGTTGCTGGAGCAAGAACATCCCGCAAGGCCGCTCCTGGGAAGCACCAGCCA
CCCGGGTAATGATCCGGTACGTTTTCGTCCCTGGCCGGGGATGGGGTTTCCAGCCAGCGAACTGCGCAAG
GGAGAAATTGATGCGGAACATCCCGACGTTCCGCCCACGGTGCGCACAACGTTTCTTGGCATGTACGGTG
TCGATTCGCCGCTGGCAGGAGGCTATCTCGATGATGTCGCCCAGCGACGTGAAGGTTATGAAGCGGTTTC
TTCGTTTCTGGATATCTTCAGCCACCGCGTCGTCACGCAGTATTACCGCATCTGGCGCAAATATGCATAC
CCGGCGACATTTGAACCTGGTGCCACGGATGCCACCTCCCAGTGCCTGCTGGGGCTGGTTGGGCTTGGCA
TTCCCGGTACGGCGCAGCATGTCGCTACGCCAGTTTCGCGTTTTCTGGCTCTGCTGGGCGCCATGCGCTT
ACCGACGCGCAATGCCGAAGGGATCCGCGCGCTGGTGAGCCTGCTGGCGCCAGATACACATGCTGATATC
AATGACCATGATCCCGTGCAAGTGCGGGTGACGAACCGCTGCGGGCTGGGGGCTGGTCGTCGCGTTCATC
TAAGGCAGCGGGCTACGCTTGGGAAAACCGCTCGCGAAGCAAACAGTCGGGTGCTTATTACATTATCCAC
CCACCATGCGCAGGAGGCGACAGACTGGCTACCGGGCGGTCAGTTGTACATGGATCTGCTGGCACTGATG
CGTGTGTATCTCGGTTATCGCAGCGACGCACGATTACGTCTGACGGTGCCGGTACATTTGCTACCGGATC
CTGCGCTCACTAAACACCGCCGCATCCAGCTGGGTCGAACTGGCCTGCTGGGGTTGAAAAACGGGAAACT
CAGCGATAACCGTCAGCTCATCACGGTCAGCCTGGGGTGTTACGAAAGCCTGAACTGCGCTGCATTACCA
TTGGCTATGAAAGGCAACTACCGCTTCGATTAA