SecReT6
Protein ID: 260597748
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19560
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2056805..2057326 [+]
Producthypothetical protein
NoteTssJ
UniProt IDC9Y3I4
KEGG IDctu:CTU_19560
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.30E-37, Aligned region: 14..163
Protein Sequence: 173 a.a.     [Download]
>gi|260597748|ref|YP_003210319.1| unnamed protein product [Cronobacter turicensis z3032]
MPNKGWHALPLVFCCLMAGCGLTQAVKDGTVSMAKSVFYKKIKTLHLDFAPRSALNVDGDQTPLATMVRI
YQLKDRKNMDAADYGTVLQNADTVLKDELLASREVLIMPNGNVSLDMPMDENAQFVAVVGLFNHPEMKDN
RWRLVLSRDDLDPDKPRRVELGDGWLKLVERKE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2056805-2057326 Cronobacter turicensis z3032 chromosome, complete genome
ATGCCAAATAAAGGATGGCATGCGCTCCCCCTGGTGTTCTGCTGCCTCATGGCCGGTTGTGGTCTTACCC
AGGCGGTGAAAGACGGTACGGTCAGTATGGCGAAATCTGTGTTTTACAAAAAAATCAAAACGCTGCACCT
CGATTTTGCGCCTCGCTCGGCGCTTAACGTGGATGGCGATCAGACGCCGCTGGCAACCATGGTAAGGATT
TACCAGCTCAAGGATCGTAAAAACATGGATGCAGCCGATTACGGCACGGTGTTGCAAAACGCAGACACCG
TGCTGAAAGACGAACTGCTGGCTTCACGCGAGGTGCTCATCATGCCCAACGGCAACGTCTCGCTGGATAT
GCCAATGGATGAAAACGCGCAATTCGTGGCAGTGGTGGGGCTGTTTAACCACCCGGAGATGAAAGACAAC
CGCTGGCGGCTGGTGCTGTCCCGCGACGATCTTGACCCGGATAAACCTCGCCGGGTGGAGCTGGGCGATG
GCTGGCTGAAGCTGGTAGAGAGAAAGGAGTGA