SecReT6
Protein ID: 260597749
SecReT6 ID364
T6SS typei2
Gene symbol-
Locus tagCTU_19570
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]2057330..2059645 [+]
Producthypothetical protein
NoteTssI
UniProt IDC9Y3I5
KEGG IDctu:CTU_19570
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-53, Aligned region: 35..342
DUF2345 [PF10106], Evalue: 1.20E-33, Aligned region: 605..729
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 473..578
T6SS_Vgr [PF13296], Evalue: 1.90E-30, Aligned region: 612..634
Phage_base_V [PF04717], Evalue: 4.10E-15, Aligned region: 373..467
Protein Sequence: 771 a.a.     [Download]
>gi|260597749|ref|YP_003210320.1| unnamed protein product [Cronobacter turicensis z3032]
MDKDNEVKPPEGLSRYVLTIHHSTISPDVLRFRGREALSEPFCWNIEFTTPQANILPEQVLMKYASLQMQ
GGRTVYGIITRLEWFSTSADQSHYSVTLSSRLALLSHARQCRVFLNQSVPEVVEQVLREHGFERADFDFR
LEREYPERELITQWRESDLTFIQRILAGVGIWWRTEMDGARGLDVTLFADSQLNYHFDVRLPYREPSGLH
DDAQEAVWGVRTWHNAVTGGVQTRDYHYPAATTPLDATVRVRSPAVTTGEHYRYAEPYREQGDDTDPEPA
GETGAFYARIHHERELNNSLRVHLFSNACSLTPGIVLEPQGDVIRALKEGVIITLTTFRASRDSRLHVSV
WGMPYSERYCYRPPEIPRPEIHGTVPARVESRDPKDTYAWLDDAGRYRVKLDMDREGGDSGYSYLWVRQA
KPYAGETYGWHTPLLTGTEVAIAFDGGDPDRPYIAHAFHDSAHPDVVNRDNRSRNILRTPAQNELRMEDK
RGEEHIHLTTEYGKTQLGEGRLVDAQNKARGAGFELRTDEYGVIRVAKGLLISADGQQKAAGEVLDRETA
LKEIDLCLQQIAQLSAAADAANALQADIASQSAMFSERLKPLNEMIHVSAPEGIAFTSSEHMQLAAAKNL
AVSAGGDISVGVMGNMTALAGEKLGLFAHSGPLSLKSGEGPVDVQAQNGGMQLAAEKKLTLTSLKDISFA
GKKRITLIGGGSYLKLEAGKIEYGTPQVYLRKVEKTFAAKAATMPITSKRLCLSCLIHAALNGTPVVLRG
N
 
Nucleotide Sequence: 2316 bp     [Download]
>gi|325295716|ref|NC_013282.2|:2057330-2059645 Cronobacter turicensis z3032 chromosome, complete genome
ATGGATAAGGATAACGAGGTTAAGCCGCCTGAGGGGCTGTCGCGGTACGTGCTTACGATCCATCACAGCA
CGATCTCTCCCGACGTGCTGCGCTTTCGCGGGCGCGAGGCGTTAAGCGAACCGTTCTGCTGGAACATTGA
ATTCACCACACCACAGGCGAACATCCTGCCGGAACAGGTGCTGATGAAGTATGCCAGTCTGCAGATGCAG
GGCGGCCGGACAGTTTACGGCATCATTACTCGCCTGGAGTGGTTCTCCACCAGTGCGGACCAGTCGCACT
ACAGCGTGACGCTATCCTCCCGGCTGGCGCTGTTGTCGCACGCGCGCCAGTGTCGCGTATTTCTCAACCA
GTCGGTGCCGGAAGTGGTGGAGCAGGTGTTGCGCGAGCATGGCTTCGAACGCGCGGATTTTGATTTCCGG
CTGGAACGGGAATATCCGGAGCGCGAGTTAATCACCCAGTGGCGCGAATCCGACCTTACGTTTATTCAGC
GCATCCTTGCCGGAGTGGGGATCTGGTGGCGTACGGAAATGGACGGTGCCCGTGGGCTGGATGTCACCCT
CTTTGCCGACAGTCAGCTTAACTATCATTTTGACGTCCGTCTGCCGTACCGCGAGCCGTCTGGCCTGCAT
GACGACGCGCAGGAGGCAGTCTGGGGCGTGCGCACCTGGCATAACGCCGTTACCGGTGGCGTGCAGACGC
GCGACTATCACTATCCCGCCGCCACGACACCGCTGGACGCCACCGTCAGGGTGCGCAGCCCGGCGGTCAC
CACCGGTGAGCACTATCGCTACGCGGAGCCGTACCGGGAGCAGGGCGATGACACTGACCCGGAGCCTGCT
GGTGAGACCGGGGCGTTTTATGCCCGGATCCATCACGAGCGGGAACTTAATAATTCGCTGCGTGTACATC
TCTTCAGCAACGCCTGCTCGCTCACGCCGGGAATCGTGCTGGAGCCGCAAGGCGACGTCATCCGCGCGCT
GAAAGAGGGGGTGATTATCACGCTCACCACTTTTCGCGCCTCGCGCGATTCGCGTCTGCACGTGTCGGTG
TGGGGGATGCCCTACAGCGAACGCTACTGCTACCGTCCGCCTGAAATCCCGCGCCCGGAAATTCACGGCA
CCGTGCCGGCGCGGGTGGAAAGCCGTGACCCGAAAGACACCTATGCCTGGCTGGATGACGCAGGACGCTA
CCGGGTGAAACTGGACATGGACCGCGAGGGCGGCGACAGCGGTTACAGCTACCTGTGGGTTCGCCAGGCG
AAGCCGTATGCCGGGGAGACGTACGGCTGGCACACGCCGCTACTGACGGGTACGGAAGTAGCCATCGCCT
TTGATGGCGGCGACCCGGACCGGCCTTATATCGCGCACGCGTTTCATGATTCCGCGCACCCGGATGTGGT
CAACCGCGACAACCGCAGCCGGAATATTCTGCGCACGCCCGCGCAGAATGAACTGCGCATGGAAGATAAA
CGGGGTGAAGAGCACATCCACCTGACCACCGAATACGGGAAAACGCAGCTTGGCGAAGGCCGGCTGGTGG
ACGCACAGAATAAAGCACGCGGGGCGGGCTTTGAACTGCGCACCGACGAATACGGCGTCATCCGGGTGGC
GAAGGGGCTGTTGATCAGCGCCGACGGGCAGCAGAAGGCGGCGGGTGAGGTACTGGACCGGGAAACGGCG
CTGAAGGAAATTGACCTCTGCCTGCAGCAGATAGCGCAACTCTCCGCTGCGGCAGACGCGGCGAACGCGC
TGCAGGCGGACATCGCGAGCCAGAGCGCGATGTTCAGCGAGCGGCTCAAACCGCTGAACGAGATGATTCA
CGTGTCGGCGCCGGAAGGGATAGCGTTCACCAGCAGTGAGCACATGCAGCTTGCGGCCGCGAAGAACCTG
GCGGTGAGTGCGGGTGGCGACATCAGCGTGGGCGTAATGGGCAACATGACCGCACTGGCGGGTGAGAAAC
TGGGGCTGTTTGCCCACAGCGGGCCGCTGAGCCTGAAATCAGGCGAAGGCCCGGTGGATGTGCAGGCACA
GAACGGCGGCATGCAGCTGGCGGCAGAGAAGAAGCTCACCCTTACTTCACTGAAAGACATTTCCTTTGCG
GGCAAAAAGCGCATCACGCTTATCGGCGGAGGAAGTTACCTGAAGCTGGAAGCCGGGAAAATAGAGTACG
GAACGCCACAGGTGTATCTGAGGAAGGTGGAGAAGACGTTTGCGGCGAAGGCGGCGACCATGCCGATCAC
GAGTAAAAGGTTATGTCTGAGCTGCCTGATTCATGCCGCGCTGAATGGAACACCTGTTGTATTGAGAGGA
AACTAA