SecReT6
Protein ID: 260842445
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0213
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]240442..240924 [-]
ProductHcp-like protein
NoteTssD
UniProt IDC8U1T1
KEGG IDeoh:ECO103_0213
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-31, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|260842445|ref|YP_003220223.1| Hcp-like protein [Escherichia coli O103:H2 str. 12009]
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELIITKPVDKSSP
LLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDI
SWEHTLAGTNAMSKWQDRVQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c240924-240442 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCAAATATAAGTTATTTATCTTTGAGTGGAGAGACACAAGGGCTGATTTCAGCAGGTTGCTCAACGC
TTGATTCTGTCGGAAACAAAGCGCAGCCAGAACATAAAGATCAGATCATGGTTTATGCGTTAATGCATTC
CATCTCAAGAAGTCAAAATGTCAATCATCATGAATTAATTATCACCAAACCGGTTGATAAATCCTCACCA
TTGCTGGCAAAAGCACTTAGTGACAATGAAAAAATGGCAATATGTGAATTTATACTCTACCGAACCAGTA
AAGCGGGTATTTACCAGCCTTATTATAAAATAAATCTGTCAAAAGCCCGAATATCAAGTATTGATTTTGT
CACACCGCATGCTGTCCTGGAAAAAGAACTGGAACCACAGGAGAGAATTGCCTTTATTTATGAAGATATT
TCCTGGGAGCATACGTTAGCCGGTACGAATGCAATGAGTAAATGGCAGGATCGTGTACAGTAA