SecReT6
Protein ID: 260842446
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0214
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]240948..242300 [-]
Producthypothetical protein
NoteTssA
UniProt IDC8U1T2
KEGG IDeoh:ECO103_0214
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 5.50E-44, Aligned region: 139..154
DUF3702 [PF12486], Evalue: 5.50E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 248..264
Protein Sequence: 450 a.a.     [Download]
>gi|260842446|ref|YP_003220224.1| hypothetical protein ECO103_0214 [Escherichia coli O103:H2 str. 12009]
MDSNGLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c242300-240948 Escherichia coli O103:H2 str. 12009, complete genome
ATGGATAGTAACGGACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGTG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCACTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAACACTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACACCCGTTGA
GTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAACGTCATGCCAGAGGCGGCAA
CCGGTACCACGGCCGAAAAATAA