SecReT6
Protein ID: 260842448
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0216
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]245854..247266 [-]
Producthypothetical protein
NoteTssA
UniProt IDC8U1T4
KEGG IDeoh:ECO103_0216
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 152..184
Protein Sequence: 470 a.a.     [Download]
>gi|260842448|ref|YP_003220226.1| hypothetical protein ECO103_0216 [Escherichia coli O103:H2 str. 12009]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQRRGLVILASES
KDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATA
QRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQP
SAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSAD
MVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGL
LFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c247266-245854 Escherichia coli O103:H2 str. 12009, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATC
GCTGGCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGGGGGCTGGTCATTCTGGCTTCGGAGAGT
AAGGATTTTCGTCTGCTGGCGCATCTGCTGAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGTCAGGGGAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAAC
TGGCACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTG
GCAGAACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGAT
ATGGTGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCG
TACTGCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAA
ACAGGTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCA
GGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCAC
GGCAGAACAATAA