SecReT6
Protein ID: 260842450
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0218
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]248011..250776 [-]
ProductATP-dependent Clp proteinase ATP-binding chain
NoteTssH
UniProt IDC8U1T6
KEGG IDeoh:ECO103_0218
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 261..261
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 644..805
AAA [PF00004], Evalue: 7.90E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 7.90E-17, Aligned region: 650..767
AAA [PF00004], Evalue: 7.90E-17, Aligned region: 779..841
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 649..769
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 811..888
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 19..48
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 620..690
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 715..743
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 446..483
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 648..683
AAA_25 [PF13481], Evalue: 6.30E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 6.30E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 6.30E-05, Aligned region: 644..678
AAA_25 [PF13481], Evalue: 6.30E-05, Aligned region: 777..841
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 8.40E-05, Aligned region: 647..674
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 649..739
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 453..453
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 650..678
NACHT [PF05729], Evalue: 9.90E-05, Aligned region: 856..879
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 643..671
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 650..668
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 650..685
IstB_IS21 [PF01695], Evalue: 0.0093, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0093, Aligned region: 649..660
AAA_17 [PF13207], Evalue: 0.0096, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0096, Aligned region: 650..684
Protein Sequence: 921 a.a.     [Download]
>gi|260842450|ref|YP_003220228.1| ATP-dependent Clp proteinase ATP-binding chain [Escherichia coli O103:H2 str. 12009]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLTMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESEQDNTGAVPADEADREQPEETAETVSPVQRLAH
LTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHK
HLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPG
YVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGY
QVIVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVI
IEPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGAFTADVEDAQN
DESVTKDETVL
 
Nucleotide Sequence: 2766 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c250776-248011 Escherichia coli O103:H2 str. 12009, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGTCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCAC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCAC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAACAGGATAATACCGGTGCCGTACCGGC
TGATGAGGCCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGTCTGGCACAT
CTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTTTCCCCGCACGTCGATAAAAAACAGA
TTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCAT
CACCGACCTGCCAAAATGGCTCGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCACAAA
CACCTGCTGACCGCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTGGGCGCGTTCCTGCTGGCTGGCC
CCAGCGGCGTGGGTAAAACTGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCT
GACCACCATCAATATGTCCGAGTTCCAGGAGAAACATACCGTCTCGCGACTGATTGGTTCGCCTCCGGGC
TACGTTGGCTACGGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAGTACTGC
TCGATGAAGTGGAAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAAT
GGCAGACGGTGAAGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTAC
CAGGTAATAGTCGAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGGCCGACT
TCTTCAAACCTGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCGCTGTCGAAAGAGACGCTCGC
CACCATCATTGCCGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGAGGTGATT
ATAGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGG
AATCGGTCATCGACGGCAATATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGCGAATAC
GGCGGTTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCTCAGAAC
GACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA