SecReT6
Protein ID: 260842456
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0224
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]255757..257607 [-]
Producthypothetical protein
NoteTssF
UniProt IDC8U1U2
KEGG IDeoh:ECO103_0224
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-196, Aligned region: 5..616
Protein Sequence: 616 a.a.     [Download]
>gi|260842456|ref|YP_003220234.1| hypothetical protein ECO103_0224 [Escherichia coli O103:H2 str. 12009]
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLC
RDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGA
DLTVGEQHIRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEF
FTLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVV
SQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVIDGSLHWSLLS
AMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLH
PEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c257607-255757 Escherichia coli O103:H2 str. 12009, complete genome
ATGGAATTTGAAGAACGCTATTTCCGGGAAGAACTCGATTACCTGCGCCAGCTTAGCAAGCTGCTGGCAA
CGGAAAAACCCCATCTGGCCCGCTTCCTGGCCGAAAAAGATGCGGATCCGGATATTGAACGCCTGCTGGA
AGGGGTGGCTTTTCTTACCGGCAATCTCCGCCAGAAAATTGAGGATGAATTCCCAGAACTGACGCACGGG
CTTATTAAGATGCTATGGCCTAATTACCTGCGTCCGGTTCCGGCAATGACCCTTATTGAATATACGCCGG
ATATGGATAAGTCTTCTGTACCGGTGTTAATCCCCCGTAATGAGCAGTTTACAACCAACGCCGGGGAAAT
CAGAGTTGATGAAGTGCTGCCCTCTGATGCTAAAAAGGAGGAGCCGCCTCCCTGTACCTTCACTCTCTGC
CGGGATATCTGGCTGCTGCCCGTTCGCCTGGAGCAGATTGAAAACCGCAGTACGACCCGTAATGGTGTTA
TCAACATCACCTTTTCGGTCGCACCGGGAACGGACTTCCGCACGCTGGATCTGAACAAACTTCGCTTCTG
GCTCGGCAATGACGACAACTATACCCGTGACCAGCTTTATTTATGGTTCTGCGAATACTTGCAGGGTGCC
GACCTGACTGTGGGTGAACAGCATATTCGCCTGCCTGAGTTTATGCTAAAAGCTGTCGGTTTTGAGCCGC
AGGATGCCATGCTGCCCTGGCCGAAAAACGTCCACAGCGGCTACCGGATCCTTCAGGAGTATTTCTGTTA
CCCCGATGCGTTTCTCTTTTTTGATCTTTGTGGTTGTCCGGCTTTGCCTGACGGATTGCAGGCGGAATTC
TTTACCCTGCAACTGCGTTTTTCGCGCCCTTTGCCTGTGGACATCCGGCTGCGCCGCGATTCCCTGCGCC
TGTATTGCGCACCTGCCATTAATTTATTTATCCACCATGCAGAAGCCATCACGCTGGACAACCGGCGGGC
AGACTATCCGCTGGTTCCCAGCCGCCATTACCCACAACATTACGATGTATTTTCCGTTAACAGTGTGGTG
AGCCAGGTCCAGGATATGTTCAGGAAAAAAGATCTGGGGCGTCCTGTTTCGACGCAGGCCGCGCGCCAGT
GGCCAGCCTTTGAAAGTTTCAGCCATCAGATGGAATACAGCCGGAAGCGGGAAGTGGTGTACTGGCATCA
CCGGACCAAAACATCCCTGTTCCATCGCGGCTTTGATCATACCCTTGCCTTTATACATGCTGATGGCAGT
TATCCGTCAGACGAATCTCTGCTCAGTAATGAAGTGGTTTCGGTATCGCTGACCTGTACCAACCGTGAGC
TTCCGTCACAAATACGTTCCGGCGATATCACCGGCACAACCGGTAAAAATGCGGCTGTTGCTTCATTTCG
CAACATTACCCGCCCGACGCAACCACTCTGGCCGGTCATTGATGGCAGCCTGCACTGGTCCCTACTCTCC
GCCATGAACCTGAATTATCTGTCATTACTGGATACGGACGCGCTGAAGCAGGTCATCGCCAACTTTGATC
GCCACGCAATCCATCATCCGCAGACGGCACGGCTGTCACAACAAAAGCTGGATGCCATTGAGCGTCTGGA
GACCCGCCCCGTTGATCGCCTGTTTACGGGTATTCCCGTCCGGGGACTGGCCTCCACGCTGTATCTGCAC
CCGGAGCCGTTTGTCTGTGAAGGGGAAATGTATCTGCTCGGTACGGTGCTTTCGCATTTTCTGTCGCTGT
ACGCCAGCGTTAACTCATTCCACATGCTGACCGTTGTGAACACAGAAAGCCAGGAGACATGGAAATGGAC
GGAAAGAATCGGGCAGCATCCTCTTATCTGA