SecReT6
Protein ID: 260842458
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0226
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]258031..259506 [-]
Producthypothetical protein
NoteTssC
UniProt IDC8U1U4
KEGG IDeoh:ECO103_0226
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-187, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|260842458|ref|YP_003220236.1| hypothetical protein ECO103_0226 [Escherichia coli O103:H2 str. 12009]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPWSPADNPVKSFNYHEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAARVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c259506-258031 Escherichia coli O103:H2 str. 12009, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTTTCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAATCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGATTCGGACAGTTTGGTGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCACCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACTGCACCCCGCTTCCTGCTTCGCCAGCCCTGGTCACCAGCAGATAA
CCCTGTTAAAAGCTTTAACTATCACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGCC
CGCAAAGCGGCGGCGCGGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTG
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAACCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAGAGG
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCGGACGTGCGCAGCCGTA
AACCTCTGCGCGCAGCCAGAGTTGAGGTTATGGATGTGGAAGGCGAACCCGGCTGGTACCAGGTTGCGCT
AAGCGTGAGGCCTCATTTTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA