SecReT6
Protein ID: 260842459
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0227
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]259557..259781 [-]
Producthypothetical protein
NoteTssC
UniProt IDC8U1U5
KEGG IDeoh:ECO103_0227
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|260842459|ref|YP_003220237.1| hypothetical protein ECO103_0227 [Escherichia coli O103:H2 str. 12009]
MTAHKNISETYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|260842239|ref|NC_013353.1|:c259781-259557 Escherichia coli O103:H2 str. 12009, complete genome
ATGACGGCACACAAAAATATCTCCGAGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA