SecReT6
Protein ID: 260842463
SecReT6 ID365
T6SS typei1
Gene symbol-
Locus tagECO103_0231
StrainEscherichia coli O103:H2 str. 12009
Repliconchromosome [GenBank: NC_013353] [Browse all T6SS(s) in this replicon]
Location [Strand]263958..268205 [+]
Productfused RhsG core protein with extension/ RhsI core protein
NotePAAR
UniProt IDC8U1U9
KEGG IDeoh:ECO103_0231
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 232..246
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 328..364
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 371..387
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 437..475
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 461..495
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 501..540
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 545..580
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 587..623
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 629..664
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 670..700
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 702..721
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 732..765
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 826..838
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 855..863
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 878..909
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 958..995
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 1010..1020
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 1043..1060
RHS_repeat [PF05593], Evalue: 5.90E-62, Aligned region: 1168..1194
RHS [PF03527], Evalue: 1.80E-20, Aligned region: 372..385
RHS [PF03527], Evalue: 1.80E-20, Aligned region: 958..966
RHS [PF03527], Evalue: 1.80E-20, Aligned region: 1162..1202
Protein Sequence: 1415 a.a.     [Download]
>gi|260842463|ref|YP_003220241.1| fused RhsG core protein with extension/ RhsI core protein [Escherichia coli O103:H2 str. 12009]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPNSPIEEQKGNPVNPLLGAKVLPGETDLALP
GPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSE
SLWLARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYR
VLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSAS
SSLVFPDTLPAGTGYGTDNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFTY
DAEHAGRMVAHHYAGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYTEGEGGLK
RVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVT
YPDGLRSSREYDERGRLTAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGY
TTRYEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGREIRYEYSAAGDLTATVSPDGKRSTIEYD
KRGRPVSVTEGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTRKLTQS
EDEGLITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVE
NPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSF
GSRAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTL
APDLDIRIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDD
ERTHHYHYDSQHRLVFHTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDG
DRLTTVQTDTTRIQTVYQPGSFTPLIRVETENGEREKAQRRSLAEKLQQEGSEDGHGVVFPAELVGLLDR
LEGEIRANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISEDGNTAWSAEYD
EWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRHRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQV
IDPMGLDAIENMTSGGLIYAVSGVPGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTK
TFGSTIADVIGKNHEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKAD
NPIKAKQGSSDASNY
 
Nucleotide Sequence: 4248 bp     [Download]
>gi|260842239|ref|NC_013353.1|:263958-268205 Escherichia coli O103:H2 str. 12009, complete genome
ATGGGCGGAAAACCGGCGGCGCGGCAGGGTGATATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CGGGGGTGCTGATAGGTGCGCCGACGGGAGTGGCCTGTTCGGTATGTCCCAACAGCCCGATAGAGGAGCA
GAAGGGTAACCCGGTGAACCCGCTGCTGGGAGCAAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCC
GGCCCGCTGCCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGG
TGTTTGGTCCCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAA
CGACAGCGGCGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAG
TCACTCTGGCTGGCGCGGGGCGGAGTAGCGGCGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGG
TGCTGCCGGAAGATGTTCGCCTGAGTCCGCATGTGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTG
GATACTCAGCTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGG
GTGCTGACGGGCGTGGTGGACGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCGGCGGAGGGTGATGTGG
CGGGCGCGGTGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGTGCTGACCACACAGGCACA
GCGGGCGGAAGTATTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCC
TCTTCTCTGGTTTTCCCCGACACGCTGCCCGCCGGTACAGGATACGGCACGGATAACGGTATCCGGCTGG
AGGCGGTATGGCTGACACACGACCCGGCATACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTACAC
GTACACGGCCGGTGGTGAACTGCGGGCGGTGTATGACCGCAGCGGAACGCAGGTGCGCGGGTTTACTTAT
GATGCGGAGCACGCCGGGCGGATGGTGGCGCACCATTATGCGGGGAGGCCGGAGAGCTGCTACCGGTATG
ATGATACCGGTCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGAGAGAG
CCGGGTAATCATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTGAAG
CGGGTGGTGAAGAAGGAACATGCGGACGGGAGCATTACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGA
AGGCACAGACGGATGCGGCGGGGCGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACGGC
GGTGACGGGGCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACG
TACCCGGACGGGCTTCGCAGCAGCCGGGAGTATGATGAGAGGGGAAGGCTGACGGCGGAGACCTCGCGCA
GCGGTGAGACAACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGAC
GGGCAGTACAAAACAGATGGCATGGAGCCGTTACGGTCAACTGCTGGCCTTCACGGACTGCTCGGGGTAC
ACGACGCGGTATGAGTACGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAGGAAGGCATCAGCACTT
ACAGCAGTTATAACCCGCGTGGGCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAATCCGTTATGA
GTACAGCGCCGCAGGCGACCTGACAGCAACGGTATCACCGGACGGTAAACGCAGCACCATCGAATATGAT
AAACGCGGGCGTCCGGTGAGTGTGACGGAAGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGC
GCATCACTGTGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTCGACAGGCTGAC
TGAACAGCGCGGTTTTGACGGCCGGACGCAACGTTACCACTATGACCTGACCAGAAAACTCACACAGAGT
GAAGACGAGGGGCTTATCACCCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACG
GCGACCCGGCAGAGCAGTGGCAGTATGATGAGCACGGGTGGTTAACCACCCTCAGCCATACCAGTGAAGG
CCACCGCGTGTCGGTCCACTACGGCTACGACGATAAGGGCCGCCTGACGGGCGAACGGCAGACGGTGGAG
AACCCGGAGACGGGGGAACTGCTGTGGCAGCATGAGACGAAACACGCCTACAACGAACAGGGGCTGGCAA
ACCGCGTCACGCCGGACAGCCTGCCGCCGGTGGAGTGGCTGACCTACGGCAGCGGTTACCTGGCGGGCAT
GAAGCTGGGCGGGACGCCGCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGAGACGGTGCGCAGCTTC
GGCAGCAGGGCAGGCAGTAATGCCGCATACGAACTGACCAGCACATACACCCCCGCAGGCCAGTTACAGA
GCCAGCACCTGAACAGCCTGGTATATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCAT
CAGCGGTCCGCGACAGACGCGGGAATACGGCTACAGCGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTC
GCACCGGACCTGGACATCCGCATCCCGTATGCCACCGACCCGGCGGGAAACCGCCTGCCGGACCCGGAGC
TACACCCGGACAGCACGCTCACGGCGTGGCCGGATAACCGCATCGCAGAGGATGCGCACTATGTTTACCA
CTATGATGAATACGGCAGACTGACGGAGAAGACGGACCGTATCCCGACGGGTGTGATACGGACGGACGAC
GAGCGGACCCACCACTACCACTACGACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCG
AGCCACTGGTCGAGAGCCGCTACCTCTACGACCCGCTGGGACGGCGAATGGCGAAACGGGTATGGCGGCG
GGAGCGTGACCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGAGACATGGTACGGCTGGGACGGC
GACAGGCTGACGACGGTACAGACCGACACCACGCGTATCCAGACGGTATACCAGCCGGGGAGCTTCACGC
CGCTCATCCGGGTCGAGACAGAGAACGGCGAGCGGGAGAAAGCGCAGCGCCGCAGCCTGGCGGAGAAGTT
ACAGCAGGAAGGGAGCGAAGACGGTCACGGTGTGGTGTTCCCGGCTGAACTGGTGGGGCTGCTGGACAGG
CTGGAGGGGGAAATCCGGGCAAACTGCGTGAGCAGTGAAAGCCGCCAGTGGCTTGCGCAGTGCGGGCTGA
CGGTGGAGCGGCTGGCGGCACAGATAGAGCCGGTTTATTTGCCTGAGCGAAAAATACATCTTTATCACTG
TGACCACCGGGGCCTGCCGCTGGCGCTTATCAGTGAAGACGGCAATACGGCGTGGAGCGCGGAATATGAT
GAATGGGGCAACCAGCTTAATGAGGAGAACCCGCATCACCTGCACCAGCCGTACCGGCTGCCGGGGCAGC
AGTATGATAAGGAGTCGGGGCTGTACTATAACCGTCACCGGTACTACGATCCGTTGCAGGGGCGGTATAT
CACCCCGGACCCGATTGGGTTGAGAGGTGGATGGAATATGTATCAGTATCCGTTGAATCCCATACAAGTG
ATAGACCCAATGGGGTTAGATGCGATTGAGAATATGACATCAGGTGGACTAATTTATGCCGTATCTGGTG
TACCTGGATTGATTGCTGCAAACAGCATTACTAACAGTGCTTACCAGTTCGGTTATGATATGGATGCTAT
TGTTGGCGGAGCTCATAATGGGGCCGCCGATGCAATGAGACATTGTTACTTGATGTGTCGAATGACTAAG
ACATTTGGATCAACAATAGCTGACGTGATAGGTAAAAATCATGAGGCGGCAGGGGATAGACAAGGTCAGC
CAGCTAAAGAAAGAATCATGGATCTTAAAAATAACACTGTCGGTATTGCTTGTGGCGATTTTTCTGCCAA
ATGTAGCGATGCATGTATTGAAAAATATAACACTGGGCAACTCTTCGGGTTAGATGGTATAAAAGCAGAT
AATCCAATAAAAGCAAAGCAAGGGAGTTCAGATGCTTCAAATTATTAG