SecReT6
Protein ID: 260853425
SecReT6 ID483
T6SS typeN/A
Gene symbol-
Locus tagECO26_0219
StrainEscherichia coli O26:H11 str. 11368
Repliconchromosome [GenBank: NC_013361] [Browse all T6SS(s) in this replicon]
Location [Strand]244343..245695 [-]
Producthypothetical protein
NoteTssA
UniProt IDC8THP1
KEGG IDeoj:ECO26_0219
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.90E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 9.90E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 9.90E-21, Aligned region: 248..264
Protein Sequence: 450 a.a.     [Download]
>gi|260853425|ref|YP_003227316.1| hypothetical protein ECO26_0219 [Escherichia coli O26:H11 str. 11368]
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQNTRKRLGPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVINQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYHDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|260853213|ref|NC_013361.1|:c245695-244343 Escherichia coli O26:H11 str. 11368 chromosome, complete genome
ATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGCG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGAACACGCGTAAACGGCTTGGACCCCAGCTGAAGAGTAACACTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTTCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAATCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACACCCGTTGA
GTCTCTGTTGACGCAGTACCATGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAACGTCATGCCAGAGGCGGCAA
CCGGTACCACGGCCGAAAAATAA