SecReT6
Protein ID: 260853428
SecReT6 ID483
T6SS typeN/A
Gene symbol-
Locus tagECO26_0224
StrainEscherichia coli O26:H11 str. 11368
Repliconchromosome [GenBank: NC_013361] [Browse all T6SS(s) in this replicon]
Location [Strand]251406..254261 [-]
ProductATP-dependent Clp proteinase ATP-binding chain
NoteTssH
UniProt IDC8THP4
KEGG IDeoj:ECO26_0224
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 674..835
AAA [PF00004], Evalue: 8.60E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 8.60E-17, Aligned region: 680..797
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 679..799
ClpB_D2-small [PF10431], Evalue: 1.30E-12, Aligned region: 841..918
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 650..720
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 745..773
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 2.40E-07, Aligned region: 678..713
AAA_29 [PF13555], Evalue: 5.00E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 5.00E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 5.00E-05, Aligned region: 677..704
AAA_25 [PF13481], Evalue: 5.60E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.60E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 5.60E-05, Aligned region: 674..708
AAA_25 [PF13481], Evalue: 5.60E-05, Aligned region: 807..871
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 453..453
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 680..708
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 886..909
AAA_14 [PF13173], Evalue: 9.70E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.70E-05, Aligned region: 679..769
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 673..701
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 680..698
Daxx [PF03344], Evalue: 0.0011, Aligned region: 448..622
AAA_18 [PF13238], Evalue: 0.005, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.005, Aligned region: 680..715
AF-4 [PF05110], Evalue: 0.0069, Aligned region: 516..569
Protein Sequence: 951 a.a.     [Download]
>gi|260853428|ref|YP_003227319.1| ATP-dependent Clp proteinase ATP-binding chain [Escherichia coli O26:H11 str. 11368]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDAADTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGHVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESESESESESESESESESESESESESESEQD
NTGAEPADEAGSEQPEETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLS
QNEMSVITDLTKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELL
YGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQ
AFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLP
LSKETLATIIAGKLARLDNVLRSRFGAEVIIEPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLL
QKMAANTAVARIRLSAVDGAFTADVEDAQNDESVTKDETVL
 
Nucleotide Sequence: 2856 bp     [Download]
>gi|260853213|ref|NC_013361.1|:c254261-251406 Escherichia coli O26:H11 str. 11368 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTTAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTGGAGAACTACACAACTGCCCGTTCTGCGGACAGCTACCCGGCATTTTCCCCGATGCTGGTTG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAATTGCGTGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAATGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCTGCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGCAAGAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCCT
TAATCGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCATGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACTTGGGCGCATTGCAGGCCGGAGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCAGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTC
AGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGCAGGAT
AATACCGGTGCCGAACCGGCTGATGAAGCTGGCAGCGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCC
CGGTACAGCGGCTGGCTCAGCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCC
GCACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTATCG
CAGAATGAAATGTCGGTCATCACCGACCTGACGAAATGGCTGGGTGACACCATCAAAGGCCAGGACCTGG
CGATTGCCAGCCTGCATAAGCATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGG
TGCGTTCCTGCTGGCTGGCCCCAGCGGTGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTC
TACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAATTCCAGGAGAAACACACCGTCTCGCGGC
TGATTGGTTCGCCTCCGGGCTACGTTGGCTACGGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAA
ACCCTACTCGGTAGTACTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAG
GCGTTCGATAAGGGCGAAATGGCAGACGGTGAAGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCC
TGACGTCCAACCTCGGCTACCAGGTAATAGTCGAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACT
GTATCCGGTGCTGGCCGACTTCTTCAAACCTGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCG
CTGTCGAAAGAGACGCTCGCCACCATCATTGCCGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCC
GCTTTGGCGCGGAGGTGATTATAGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGA
AAACGGCGCGAGGATGCTGGAATCGGTCATCGACGGCAATATGCTGCCGCCGCTCTCCCTGCTGCTGTTG
CAGAAAATGGCGGCGAATACGGCGGTTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAG
ACGTGGAAGATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA