SecReT6
Protein ID: 260853429
SecReT6 ID483
T6SS typeN/A
Gene symbol-
Locus tagECO26_0225
StrainEscherichia coli O26:H11 str. 11368
Repliconchromosome [GenBank: NC_013361] [Browse all T6SS(s) in this replicon]
Location [Strand]254270..255031 [-]
Producthypothetical protein
NoteTssL
UniProt IDC8THP5
KEGG IDeoj:ECO26_0225
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|260853429|ref|YP_003227320.1| hypothetical protein ECO26_0225 [Escherichia coli O26:H11 str. 11368]
MDEGSLSLPPFTGYDEKSQRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTIKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|260853213|ref|NC_013361.1|:c255031-254270 Escherichia coli O26:H11 str. 11368 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCAGCGCGACTATCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCAGCCACGCCGCTCCTCGGTATGGTGATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACGGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGAGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGCCTGTACCACGTCCTGCATAAACT
ACGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACCATTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA