SecReT6
Protein ID: 260866373
SecReT6 ID367
T6SS typei1
Gene symbol-
Locus tagECO111_0233
StrainEscherichia coli O111:H- str. 11128
Repliconchromosome [GenBank: NC_013364] [Browse all T6SS(s) in this replicon]
Location [Strand]260505..260729 [-]
Producthypothetical protein
NoteTssC
UniProt IDC8UH91
KEGG IDeoi:ECO111_0233
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|260866373|ref|YP_003232775.1| hypothetical protein ECO111_0233 [Escherichia coli O111:H- str. 11128]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|260866153|ref|NC_013364.1|:c260729-260505 Escherichia coli O111:H- str. 11128, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA