SecReT6
Protein ID: 260866374
SecReT6 ID367
T6SS typei1
Gene symbol-
Locus tagECO111_0234
StrainEscherichia coli O111:H- str. 11128
Repliconchromosome [GenBank: NC_013364] [Browse all T6SS(s) in this replicon]
Location [Strand]260764..261264 [-]
Producthypothetical protein
NoteTssB
UniProt IDC8UH92
KEGG IDeoi:ECO111_0234
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|260866374|ref|YP_003232776.1| hypothetical protein ECO111_0234 [Escherichia coli O111:H- str. 11128]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|260866153|ref|NC_013364.1|:c261264-260764 Escherichia coli O111:H- str. 11128, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCCCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACGCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA