SecReT6
Protein ID: 260866376
SecReT6 ID367
T6SS typei1
Gene symbol-
Locus tagECO111_0236
StrainEscherichia coli O111:H- str. 11128
Repliconchromosome [GenBank: NC_013364] [Browse all T6SS(s) in this replicon]
Location [Strand]262689..264830 [+]
ProductVgrG protein
NoteTssI
UniProt IDC8UH94
KEGG IDeoi:ECO111_0236
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-62, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 2.90E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|260866376|ref|YP_003232778.1| VgrG protein [Escherichia coli O111:H- str. 11128]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYLTIWQGDDVQR
RVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTTLDNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQESSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|260866153|ref|NC_013364.1|:262689-264830 Escherichia coli O111:H- str. 11128, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTTTTTTCCCTCGATCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTCCAGCAGATCCTCGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTATGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTGTGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGCTGTTCAGCGAGCCACAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTGAGCACCCTCTGC
ATCAGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGTGCCCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCGCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCAAGTGAACTGCACGGCGAACA
GCCGCAGGCGGTACCGGGACGCAGGGGTTCAGGCACCACGCTGGATAACCACTTTGCGGTAATCCCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGAAAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGCTTTGGT
AACCTGGCGATACCGCGTGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TCATTATGGGGCGTACCTACCACCAGGAAAACCGCACCCCCGGCAGCCTGCCGGGGACGAAGACGCAGAT
GACGATCCGCTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACTGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTGGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGA
CGGTAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTGGGGAATAACGTCACCTTCTCGGTGGGCAAGACAATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTCAATGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA