SecReT6
Protein ID: 260866377
SecReT6 ID367
T6SS typei1
Gene symbol-
Locus tagECO111_0237
StrainEscherichia coli O111:H- str. 11128
Repliconchromosome [GenBank: NC_013364] [Browse all T6SS(s) in this replicon]
Location [Strand]264906..269135 [+]
Productfused putative RhsG core protein with extension/putative RhsI core protein
NotePAAR
UniProt IDC8UH95
KEGG IDeoi:ECO111_0237
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 210..243
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 353..384
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 434..489
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 495..534
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 539..574
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 581..617
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 623..658
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 664..694
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 696..715
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 726..759
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 820..832
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 849..857
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 872..903
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 952..989
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 1004..1014
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 1037..1054
RHS_repeat [PF05593], Evalue: 6.00E-61, Aligned region: 1162..1188
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 369..382
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 952..960
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 1156..1196
Protein Sequence: 1409 a.a.     [Download]
>gi|260866377|ref|YP_003232779.1| fused putative RhsG core protein with extension/putative RhsI core protein [Escherichia coli O111:H- str. 11128]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPLLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESLW
LARGGVAEQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLTFHRAAEGDVAGAVTGVTDGAGRCFHLVLTTQAQRAEAFRKQRATSLSSPAGPRSASSSS
AFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTASGELRAVYDRSGTQVRGFTYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTGPDGRTVRYGYNSQRQVTSVTYPDGLR
SSREYDEKGRLAAETSRSGETTSYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGYTTRYEY
DRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTATVSPDGKRSTIAYDKRGRPV
SVTEGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTRKLTQSEDEGLI
TLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPETGE
LLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSRAGS
NAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPGLDI
RIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDDERTHHY
HYDSQHRLVFHTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTV
QTDTTRIQTVYQPGSFAPLIRIETDNGEREKAQCRSLAEKIQQEGSEDGHGVVFPAELVGLLDRLEGEIR
ANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISEDGNTAWSAEYDEWGNQL
NEENPHHLHQPYRLPGQQYDKESGLYYNRHRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGL
DAIENMTSGGLIYAVSGVPGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTKTFGSII
ADVIGKNHEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKADNPIKAK
QGSSDASNY
 
Nucleotide Sequence: 4230 bp     [Download]
>gi|260866153|ref|NC_013364.1|:264906-269135 Escherichia coli O111:H- str. 11128, complete genome
ATGGGCGGAAAACCGGCGGCGCGGCAGGGTGATATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CGGGGGTGCTGATAGGTGCGCCGACGGGAGTGGCCTGTTCGGTATGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGCTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAACGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCACTCTGG
CTGGCGCGGGGCGGGGTGGCGGAGCAGCACAGTTCGCAGCCGCTAAGCGCACTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATGTGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAG
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGACGGCTTCGGGCGGACGCTGACTTTCCACCGGGCGGCGGAGGGTGACGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCTGTTTTCACCTGGTGCTGACCACACAGGCGCAGCGGGCGGA
AGCCTTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCCTCTTCTTCT
GCTTTCCCCGACACGCTGCCCGCCGGTACAGAATACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTGT
GGCTGACACACGACCCGGCATACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTACACGTACACGGC
CAGCGGAGAACTGCGGGCGGTGTATGACCGCAGCGGGACGCAGGTTCGCGGGTTTACTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCACACCATTATGCGGGGAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GTCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAGGGCGAGGGCGGCCTGAAGCGGGTGGTG
AAGAAGGAACATGCGGACGGGAGCATTACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCACAGA
CGGATGCGGCGGGGCGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACGGGGCCGGACGG
CAGGACGGTACGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCGGTGACGTACCCGGACGGGCTTCGC
AGCAGCCGGGAGTATGATGAGAAGGGAAGGCTGGCGGCGGAGACCTCACGCAGCGGTGAGACGACGAGTT
ACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTACAAAACAGAT
GGCATGGAGCCGTTACGGTCAACTGCTGGCCTTTACGGACTGCTCGGGGTACACGACGCGGTATGAGTAC
GACCGGTACGGTCAACAAATCGCCGTTCACCGGGAGGAAGGCATCAGCACTTACAGCAGTTATAACCCGC
GTGGGCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCGTTATGAGTACAGCGCCGCAGGAGA
CCTGACAGCAACGGTATCACCGGACGGTAAACGCAGCACCATCGCATATGATAAACGCGGGCGTCCGGTG
AGTGTGACGGAAGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCGTGCTGACCA
ACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTTGACAGGCTGACTGAACAGCGCGGTTTTGA
CGGCCGGACGCAACGTTACCACTATGACCTGACCAGAAAACTCACACAGAGTGAAGACGAGGGGCTTATC
ACTCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACGGCGACCCGGCAGAGCAGT
GGCAGTATGATGAGCACGGGTGGTTAACCACCCTCAGCCATACCAGTGAAGGCCACCGAGTGTCGGTCCA
CTACGGGTACGACGATAAGGGCCGCCTGACGGGCGAACGGCAGACGGTGGAGAACCCGGAGACGGGGGAA
CTGCTGTGGCAGCATGAGACGAAACACGCCTACAACGAACAGGGGCTGGCAAACCGCGTCACGCCGGACA
GCCTGCCGCCGGTGGAGTGGCTGACCTACGGCAGCGGTTACCTGGCGGGCATGAAGCTGGGCGGGACGCC
GCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGAGACGGTGCGCAGCTTCGGCAGCAGGGCAGGCAGT
AATGCCGCATATGAACTGACCAGCACATACACCCCCGCAGGCCAGTTACAGAGCCAGCACCTGAACAGCC
TGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCATCAGCGGCCCGCGACAGAC
GCGGGAATACGGCTACAGTGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTCGCACCGGGCCTGGACATC
CGCATCCCGTATGCCACCGACCCGGCGGGAAACCGCCTGCCGGACCCGGAGCTACACCCGGACAGCACGC
TCACGGCGTGGCCGGATAACCGCATCGCAGAGGATGCGCACTATGTTTACCACTATGATGAATACGGCAG
ACTGACGGAGAAGACGGACCGCATCCCGACGGGTGTGATACGGACGGACGACGAGCGGACCCACCACTAC
CACTACGACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCGAGCCACTGGTCGAGAGCC
GCTACCTCTACGACCCGCTGGGACGGCGAATGGCGAAACGGGTATGGCGGCGGGAGCGTGACCTGACGGG
GTGGATGTCGCTGTCGCGTAAACCGGAGGAGACATGGTACGGCTGGGACGGCGACAGGCTGACGACGGTA
CAGACCGACACCACGCGTATCCAGACGGTATACCAGCCGGGGAGCTTCGCGCCGCTCATCCGCATCGAAA
CAGACAACGGTGAACGGGAGAAAGCGCAGTGCCGCAGCCTGGCGGAGAAGATACAGCAGGAAGGGAGCGA
AGACGGTCACGGTGTGGTGTTCCCGGCTGAACTGGTGGGGCTGCTGGACAGGCTGGAGGGGGAAATCCGG
GCAAACTGCGTGAGCAGTGAAAGCCGCCAGTGGCTTGCGCAGTGCGGGCTGACGGTGGAGCGGCTGGCGG
CACAGATAGAGCCGGTTTATTTGCCTGAGCGAAAAATACATCTTTATCACTGTGACCACCGGGGCCTGCC
GCTGGCGCTTATCAGTGAAGACGGCAATACGGCGTGGAGCGCGGAATATGATGAATGGGGCAACCAGCTT
AATGAGGAGAACCCGCATCACCTGCACCAGCCGTACCGGCTGCCGGGGCAGCAGTATGATAAGGAGTCGG
GGCTGTACTATAACCGTCACCGGTACTACGATCCGTTGCAGGGGCGGTATATCACCCCGGACCCGATTGG
GTTGAGAGGTGGATGGAATATGTATCAGTATCCGTTGAATCCCATACAAGTGATAGACCCAATGGGGTTA
GATGCGATTGAGAATATGACATCAGGTGGACTAATTTATGCCGTATCTGGTGTACCTGGATTGATTGCTG
CAAACAGCATTACTAACAGTGCTTACCAGTTCGGTTATGATATGGATGCTATTGTTGGCGGAGCTCATAA
TGGGGCCGCCGATGCAATGAGACATTGTTACTTGATGTGTCGAATGACTAAGACATTTGGATCAATAATA
GCTGACGTGATAGGTAAAAATCATGAGGCGGCAGGGGATAGACAAGGTCAGCCAGCTAAAGAAAGAATCA
TGGATCTTAAAAATAACACTGTCGGTATTGCTTGTGGCGATTTTTCTGCCAAATGTAGCGATGCATGTAT
TGAAAAATATAACACTGGGCAACTCTTCGGGTTAGATGGTATAAAAGCAGATAATCCAATAAAAGCAAAG
CAAGGGAGTTCAGATGCTTCAAATTATTAG