SecReT6
Protein ID: 261820385
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1070
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1157817..1158320 [+]
Producthypothetical protein
NoteTssB
UniProt IDD0KJ43
KEGG IDpwa:Pecwa_1070
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.40E-57, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|261820385|ref|YP_003258491.1| hypothetical protein Pecwa_1070 [Pectobacterium wasabiae WPP163]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEESQDDLPVKLSIAGLNDFSPDRIAQQVPELRKLLDLREALVALKGPLGNIPSFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1157817-1158320 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCAAAAGGAACTGATGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTTCCGGCCA
CTGGTGGTCAGCAGGCGGAAATAGAATTGCCGTTGACGCTGATGATCGTGGGAAATATGAAAGGGCGCAC
AGAGGAAACGCCGATCGAAGAACGTCAGACCGTATCGATCGATAAGAACAATTTTACCTCCGTGATGAAA
GAAGCCAATCTGGAACTGAATTTCAGTGTGCCAAATCGCCTTGAAGAAGAGAGCCAAGACGACCTGCCAG
TGAAACTGAGTATTGCTGGCTTGAATGATTTTTCTCCTGACCGCATCGCCCAACAAGTGCCTGAATTACG
TAAGTTGCTTGATTTACGTGAAGCATTGGTCGCGCTGAAAGGCCCCCTCGGCAATATTCCCTCATTCCGT
AATCGTTTGCAGGATCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTTTTGAAAGAGCTCGATCTGGTGA
AACCCGCCGAATAA