SecReT6
Protein ID: 261820386
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1071
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1158353..1159831 [+]
Producthypothetical protein
NoteTssC
UniProt IDD0KJ44
KEGG IDpwa:Pecwa_1071
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-184, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|261820386|ref|YP_003258492.1| hypothetical protein Pecwa_1071 [Pectobacterium wasabiae WPP163]
MSIVEEQVQAGAASASGSLLDDIMAQARISPVDEGYSVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAKELQELESSWRSMKLLIDRTDFRENIKLLVLHATKEELLEDFEFAPEISQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDRFTDLPSIK
DLKSVFEGPAYTKWRSLRESEDGRYLGLTAPRFLARLPYDPVENPIKGFNYKEDISTDHEHYLWGNTAYL
MGTALTDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWIKQYIADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMSVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1158353-1159831 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCAATAGTTGAAGAACAGGTTCAGGCAGGAGCCGCCAGTGCTTCTGGATCGTTGCTTGATGACATCA
TGGCTCAAGCGCGTATCAGCCCGGTTGATGAAGGCTACAGCGTGGCTAAACAGGGCATTGCCGCGCTGGT
TGCTAACATTCTTGATAGCGGTAATGCAGCAGAACCCGTGAATAAAGCGCTGGTCGATAGCATGATCGTC
GAACTGGACAAAAAACTTAGCAAGCAGATTGACGTGATTCTGCATGCAAAAGAATTACAGGAACTGGAAT
CTTCCTGGCGTTCGATGAAACTGCTTATCGATCGCACTGATTTCCGTGAAAACATCAAACTGTTGGTGTT
GCATGCGACGAAAGAAGAGCTGTTGGAAGATTTCGAATTCGCCCCTGAAATCTCACAGTCTGGCTTCTAT
AAGCACGTGTATTCCAGCGGTTACGGCCAGTTCGGCGGTCAGCCTATTGGTGGCGTGATCGGTGACTATG
CGCTGACGCAAAGCTCACCAGACATCAAACTGATGCAGTATGTCAGCGCCGTTGGCGCGATGGCGCATGC
ACCGTTCATCTCTTCCGTTGCACCAACCTTCTTTGGCGTGGATCGCTTCACCGATCTGCCTTCAATCAAA
GATCTGAAATCCGTTTTCGAAGGCCCTGCCTACACGAAATGGCGTTCGCTGCGTGAATCTGAAGACGGCC
GCTATCTGGGGCTGACGGCACCGCGCTTCCTAGCTCGCTTGCCTTATGATCCGGTAGAAAACCCGATTAA
GGGTTTCAACTACAAGGAAGATATCAGCACCGATCACGAACACTATCTGTGGGGCAATACCGCTTATCTG
ATGGGAACGGCATTGACGGACAGTTTCGCGAAATACCGCTGGTGTCCGAACATTATCGGTCCACAGAGCG
GTGGGGCGATTACCGACCTGCCGGTGCATGTTTATGAAGCGATGGGCCAACTTCAGGCCAAGATCCCGAC
TGAAGTGCTGATCACCGATCGTCGCGAATATGAAATGGCCGAAGAAGGCTTTATCACGCTGACGATGCGT
AAAGACAGTGACAATGCCGCCTTCTTCTCCGCTAACTCAGTGCAGAAGCCGAAGGTGTTCCCAAACACCA
AGGAAGGCAAAGAAGCGGAAACCAACTACAAGCTGGGTACGCAACTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTGCTTCAGCGTGAACAGATTGGCTCATGGAAAGAGCGTCAGGATCTTGAA
CGTGAGTTGAATACCTGGATTAAACAGTACATCGCCGATCAGGAAAACCCGCCGGCAGATGTCCGTAGCC
GTCGTCCTCTGCGTGCTGCACAAATCAAAGTGCTGGATGTGGAAGGAGAACCAGGTTGGTATCAGGTCAC
TATGTCTGTGCGCCCGCACTTCAAGTACATGGGGGCAAACTTTGAGCTGTCGCTGGTAGGGCGTCTGGAT
AAGGAATAA