SecReT6
Protein ID: 261820387
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1072
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1159837..1160268 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD0KJ45
KEGG IDpwa:Pecwa_1072
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.80E-20, Aligned region: 33..123
Protein Sequence: 143 a.a.     [Download]
>gi|261820387|ref|YP_003258493.1| type VI secretion system lysozyme-like protein [Pectobacterium wasabiae WPP163]
MPSLSAWERGNAASLFDRIRGEERRSSPETDVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVDTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHY
RMI
 
Nucleotide Sequence: 432 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1159837-1160268 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAACGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGAGC
GTCGTTCCTCCCCTGAAACGGACGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAACTGGACAATGTGCT
CAACACCCGGCCCGGAAATTGTCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAG
GGTGGTGCGGATATTCGGGGGAAAATCCGGGAGGCGATCCGGCAGTGTATCTGTCGCTTTGAACCTCGAA
TTGTTCATGTGGATGTCGACACATCGGACTATTTATCGAATCCGATGGAGATGTCGTTTCAGGTTACCGC
TCGGGTCAGGTTGGAAGACCTGGAGCAGGTTGCCTCTTTCAATATCCATATGGATAGCCACCGCCATTAC
AGAATGATCTGA