SecReT6
Protein ID: 261820388
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1073
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1160271..1162037 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0KJ46
KEGG IDpwa:Pecwa_1073
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-200, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|261820388|ref|YP_003258494.1| hypothetical protein Pecwa_1073 [Pectobacterium wasabiae WPP163]
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTMMQFSVHPGAIAQPAFVERGCELDSLPIDDVVCHFQTCHDIWIYPADIREIKVQ
SGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAYELYFWIASQLSHIELEVDGQRFRQEASVLK
TVGFEREDALLPYPGNVYSGYRILQEYFCFPESFLFFQLAGAVWPDLPLTVTEFRLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFRHDSEPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRARGIPRTY
QPFESFQHQIERAKGRLALYYRIRIREAVNGNGFEHMLSFVRGDEREVIDLDESISVTLTCTNRSRAAQL
PVGAICVPAGNSPSFATFRNLLRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1160271-1162037 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCACTGGAACATTTTTTCAGGGATGAGCTGACTTACTTGCGCCTGCAAGGGCGCGAATTCGCCAAGG
CGCACCCTGAGCTTACCCGATTTTTGTCAGAACAAACCACGGATCCAGACGTTGAGCGACTGCTGGAAGG
GTTCGCCTTTTTGACAGGGAGCCTGCGGGCGAAGATCGAGGATGAATTTCCGGAACTGACACACGGTCTG
CTGGGCATGCTCTGGCCTAATTACCTGCGTCCAGTACCGAGCATGACGATGATGCAATTTTCGGTGCATC
CTGGCGCGATTGCACAGCCCGCATTTGTTGAGCGCGGTTGTGAACTCGATAGCCTGCCGATTGATGATGT
GGTCTGCCATTTTCAGACCTGTCACGATATCTGGATTTATCCGGCGGATATCCGCGAGATTAAGGTACAA
AGCGGTAACGATCTTTCCACCATTACGCTGGATATAGGGTTGCATGGCCCGTTATCGCTAAGCGATCTGC
AACTCGACAAGCTGCGCTTTTATCTGGGCGGCGATACCTATACGGCCTACGAACTCTATTTCTGGATCGC
CAGCCAACTGTCGCATATTGAGCTGGAAGTCGATGGCCAACGCTTCCGTCAAGAGGCCAGCGTGCTGAAG
ACGGTCGGCTTCGAGCGAGAAGATGCGCTATTACCGTATCCCGGCAATGTCTATTCGGGCTACCGCATCC
TGCAGGAATACTTTTGCTTTCCTGAAAGTTTTCTCTTTTTCCAACTTGCTGGCGCGGTATGGCCGGATCT
TCCGCTGACGGTAACGGAGTTCCGTCTGCATTTTTGTTTTGATCGTCCGTTGCCAGCGGAGCTGAAGATC
CGTCCTGATTCATTCATGCTCAACTGCGTGCCTGCAATCAATCTCTTCCGACACGATAGCGAGCCGATCA
ACCTTAGCGGACGCCAGACGGATTACCCGCTGAAGGCCAGTTACCGTAACGCCGATAGCTTTGAAATCTT
CTCTGTGGATAAGGTTGAGGGGTGGGTTGAAGGCAATTCAGGTCGTGCTCGGGGTATCCCACGCACGTAT
CAGCCCTTTGAGAGCTTTCAGCACCAAATCGAGCGAGCTAAAGGGCGATTGGCGCTCTATTACCGTATTC
GGATAAGAGAAGCGGTGAACGGCAATGGTTTTGAACACATGCTCTCTTTTGTGCGGGGCGATGAGCGGGA
AGTCATTGATTTGGATGAATCCATCTCGGTGACTCTGACCTGTACCAATCGGTCGCGTGCGGCACAACTG
CCCGTTGGGGCGATTTGTGTACCAGCCGGTAACTCACCGTCTTTCGCGACGTTTCGTAATTTGTTACGGC
CAACGCGGCCACTGCGGCCTGCGATGGATGGCAGCCTGCATTGGACGCTGATCTCCAACCTGTCGCTGAA
CTATGTGTCGCTGCTGCGGCGTGATGCGTTGGTACAGATCCTACGTACCTACGATTTCCCAGCGCTGCAC
GACAAGCAGGCGGAACAAGCCTCGCGTAAGCGTCTGGCGGGTATCGAGTCTATCGAAACCACGCCTATCG
ATCGCCTGGTTCAGGGGATGCCGGTTCGTGGCTTGAAATCAATCCTGTCTGTACGGCAATCCGCGTTTTC
CAGTGAAGGAGAACTGTACCTGTTTAGCACGGTGCTGGCGCACTTTTTCTCGCTATACGCCAGCGTCAAC
GCTTTCCACCTGTTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AACACTCAATGATGTAA