SecReT6
Protein ID: 261820389
SecReT6 ID368
T6SS typei1
Gene symbol-
Locus tagPecwa_1074
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]1162001..1162999 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0KJ47
KEGG IDpwa:Pecwa_1074
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.60E-96, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|261820389|ref|YP_003258495.1| hypothetical protein Pecwa_1074 [Pectobacterium wasabiae WPP163]
MAGTDRSTLNDVTFRQDVSRFNFFQLVELLNQLEGVDLEQELDFRPEQERLRFRSTASIGFHPSDILRVG
CDEEGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYRYHVRF
QNEGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGVLASPSRSPEVVAGLVIHCFDLDDVAVLAWQ
HRRVPIHEGQQNRLGKGNMMLGGDFVIGDKVNDCAGKFLLKIGNLSFSRFLSFLPNGEHFQPLVRFVSFI
LRDQLAWDLRLGFAEDEAKGLSLGSEQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|261819370|ref|NC_013421.1|:1162001-1162999 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCCGGTACAGATAGGTCAACACTCAATGATGTAACGTTCCGTCAGGATGTCTCACGCTTCAATTTTT
TCCAACTGGTGGAATTACTCAACCAGTTGGAAGGCGTGGATCTGGAACAAGAGCTGGATTTTCGCCCTGA
ACAGGAACGTCTGCGTTTTCGCTCCACGGCCTCCATCGGTTTTCACCCCAGCGATATCTTGCGGGTGGGG
TGTGATGAAGAGGGCCGTCAGGAATTGGAAGTCGCGTTCCTGGGCCTGCACGGTAGTCAGTCGCCGATGC
CCGGCTATTACCTCGAAGAACTGGCTTGGGAATACGCGCAGGGCGAACAGAAGCTGGGCGTGTTTCTCGA
TTTCTTTCATCACCGCTTACTCACGCTGTTGCACCGCGCATGGCGGAAATATCGCTATCACGTCCGCTTT
CAGAATGAGGGGGAGGATGGATTCTCCCGTCTGATGTTTGCGCTCGTGGGCTTGGGCAATGATGCCGTGC
GCGACAGTCTGCCGGTTAACCGCGCCAAGATGCTTTCCTACGCTGGGGTGTTGGCAAGCCCCAGCCGTTC
CCCTGAAGTGGTCGCCGGGTTAGTTATTCACTGTTTTGACCTGGATGATGTTGCCGTCTTGGCCTGGCAG
CACCGGCGCGTTCCCATTCATGAAGGGCAGCAGAACCGGCTGGGAAAAGGAAACATGATGCTGGGCGGTG
ATTTTGTCATCGGTGACAAAGTGAATGATTGTGCCGGCAAGTTTTTGCTCAAGATCGGCAATCTCAGTTT
TAGCCGCTTTCTCAGCTTTCTGCCCAACGGTGAACATTTTCAGCCGCTGGTGCGTTTTGTCTCTTTCATT
CTTCGCGATCAGTTGGCTTGGGATCTCCGTCTTGGTTTCGCAGAAGATGAAGCTAAGGGCTTAAGTCTGG
GCAGCGAGCAAAGCAGCCGTTTGGGGTGGAGCAGCTTTCTCGGGCAGCCGCCAGCGGATCCCTATGTGAC
GATTTGTGTGCAGGAGTAA